SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041276 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041276
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000641
Family Ribosomal protein L24e 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041276   Gene: ENSMMUG00000032545   Transcript: ENSMMUT00000048237
Sequence length 68
Comment pep:known chromosome:MMUL_1:X:1566319:1566522:1 gene:ENSMMUG00000032545 transcript:ENSMMUT00000048237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVEVCSFRGYKIYPRHGRRYARTNDGKVFQCLKAKCELAFLSKRNPWQVNWTLLYRRKH
KKGQLEEI
Download sequence
Identical sequences 9544.ENSMMUP00000041276 ENSMMUP00000041276 ENSMMUP00000041276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]