SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041350 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041350
Domain Number 1 Region: 1-46
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000217
Family Proprotein convertase P-domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041350   Gene: ENSMMUG00000032585   Transcript: ENSMMUT00000048314
Sequence length 82
Comment pep:known scaffold:MMUL_1:1099214727625:769:2085:-1 gene:ENSMMUG00000032585 transcript:ENSMMUT00000048314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSTVRCWGERARGTYRLVVRDVGDESFQVGILRQWQLTLYGSVWSPVDIRDRQRLLESAM
SGKYLHDDFTLPCPPGLKIPEE
Download sequence
Identical sequences ENSMMUP00000041352 9544.ENSMMUP00000041352 ENSMMUP00000041350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]