SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000440 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000440
Domain Number 1 Region: 1275-1417
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-51
Family Phosphotyrosine-binding domain (PTB) 0.00000011
Further Details:      
 
Domain Number 2 Region: 307-434
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.19e-37
Family PLC-like (P variant) 0.0034
Further Details:      
 
Domain Number 3 Region: 139-305
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.62e-25
Family Dual specificity phosphatase-like 0.00025
Further Details:      
 
Domain Number 4 Region: 1123-1271
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-24
Family SH2 domain 0.0016
Further Details:      
 
Domain Number 5 Region: 30-90
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000763
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000440   Gene: ENSMMUG00000000318   Transcript: ENSMMUT00000000476
Sequence length 1419
Comment pep:known chromosome:MMUL_1:11:50118762:50125053:1 gene:ENSMMUG00000000318 transcript:ENSMMUT00000000476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMKPRKAEPHSFREKVFRKKPPVCAVCK
VTVDGTGVSCRVCKVATHRKCEAKVTSACQALPPAELRRNTAPVRRIEHLGSTKSLNHSK
QRSTLPRSFSLDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHR
DKYLLFNLSEKRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLY
CKGSKGKLGVIVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQPSQRRYISYFSGL
LSGSIRMNSSPLFLHYVLVPTLPAFEPGTGFQPFLKIYQSMQLVYTSGVYHIAGPGPQQL
CISLEPALLLKGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPQLTFPKDQLDEAWTDE
RFPFQASVEFVFSSSPEKIKGSTPRNDPSVSVDYNTTEPAVRWDSYENFNRHHEDSVDGS
LTHTRGPLDGSPYAQVQRPPRQTPPAPSPEPPPPPMLSVSSDSGHSSTLTTEPAAESPGR
PPPTAAERQELDRLLGGCGVASGGRGAGRETAILDDEEQPTVGGGPHLGVYPGHRPGLSR
HCSCRQGYRESCGVPNGGYYRPEGTLERRRLAYGGYEGSPQGYAEASMEKRRLCRSLSEG
PYPCPPEMGKPATGDFGYRAPGYREVVILEDPGLPALYPCPACEEKLALPTAALYGLRLE
REAGEGWATEAGKPLLHSVRPGHPLPLLLPACGHHHAPMPDYSCLKSPKAGEEGHEGCSY
TMCPEGRYGHPGYPALVTYSYGGAVPSYCPAYGRVPHSCGSPGEGRGYPSPGAHSPRAGS
ISPGSPPYPQSRKLSYEIPTEEGGNRYPLPGHLASAGPLASAESLEPVSWREGPSGHSTL
PRSPRDAPGSASSELSGPSTPLHTSSPVQGKESTRRQDTRSPTSAPTQRLSPGEALPPVS
QAGTGKAPELPSGSGPEPPAPSPVSPTFPPSSPSDWPQERSPGGLSDGASPRSPVPTTLP
GLRHAPWQGPRGPPDSPDGSPLTPVPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLTQ
PPLPEKRHLPGPGQQPGPWGPERASSPARGISHHVTFAPLLSDNVPQPPEPPTQESQSNV
KFVQDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPW
KGDPLEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLHIPSKDP
LEETPEAPVPTNMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPT
PAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVA
KKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK
Download sequence
Identical sequences A0A1D5QKQ8
9544.ENSMMUP00000000442 ENSMMUP00000000440 ENSMMUP00000000442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]