SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000447 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000447
Domain Number 1 Region: 212-328,392-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-17
Family SPRY domain 0.035
Further Details:      
 
Domain Number 2 Region: 42-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000396
Family SPRY domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000447   Gene: ENSMMUG00000000329   Transcript: ENSMMUT00000000483
Sequence length 435
Comment pep:known chromosome:MMUL_1:11:50125308:50138458:-1 gene:ENSMMUG00000000329 transcript:ENSMMUT00000000483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHGNSGEVGC
YVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHADDGKLYN
GRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPDGLFPAVG
MHSLGEEPEIFVKPGKVGPRLSWAQVSRVGVSLSPDPRLAFPPQLLEYLGKGKSIVDVGL
AQARHPLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHADDGKIFH
GSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVRNVRNVMY
LHQEGEEEEEEEEEEEDGEEIEPEHEGRKVVVFFTRNGKIIGKKDAVVPSGGFFPTIGML
SCGEKVKVDLHPLSG
Download sequence
Identical sequences 9544.ENSMMUP00000000447 ENSMMUP00000000447 ENSMMUP00000000447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]