SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000513 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000513
Domain Number 1 Region: 253-405
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-23
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 57-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-21
Family First domain of FERM 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000513
Domain Number - Region: 491-554
Classification Level Classification E-value
Superfamily Prefoldin 0.0942
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000513   Gene: ENSMMUG00000000387   Transcript: ENSMMUT00000000559
Sequence length 1034
Comment pep:known chromosome:MMUL_1:2:66773348:66982355:1 gene:ENSMMUG00000000387 transcript:ENSMMUT00000000559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLQDVYQMTEGRH
CQVHLLDDRRLELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWLQLDHRV
LDHDLPKKPGPTVLHFAVRFYIESISFLKDKTTVELFFLNAKACVHKGQIEVDSETIFKL
AAFVLQEAKGDYTSDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKIKGLTRGQ
AVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDIQDKVKPRKLFQWKQLE
NLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMAISQHQFYLDR
KQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLEAKSQFIMASNGSLISSGSQDSEVSE
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNVGEKPPQVRRR
VGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTD
AVKKLQEIENAINEYRIRCGKKPSQKAAVLPEDIIPSESSSLSDTTTFDDPSDAFTLAGQ
RSSSVPHSPRILPPKSLGIERIHFRKSSINEQFVDTRQSREMLSTHSSPYKTLERRPQGG
RSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMDSDKPFFSLSKSQRS
SSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQSVSTSNSGSMP
NLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGSYVYENDTEGQYSVNPSYR
SSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLR
GWYQRATGQKDQGHSLQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSVSSTNASGNW
RTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQLDGTDGNRLEDNLESSEQ
RLFWHEDSKPGTLV
Download sequence
Identical sequences F6X616
9544.ENSMMUP00000000513 XP_014985908.1.72884 ENSMMUP00000000513 ENSMMUP00000000513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]