SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000721 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000721
Domain Number 1 Region: 2-291
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 1.31e-111
Family S-adenosylmethionine decarboxylase 0.0000000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000721   Gene: ENSMMUG00000000535   Transcript: ENSMMUT00000000779
Sequence length 298
Comment pep:known chromosome:MMUL_1:4:153043534:153050318:-1 gene:ENSMMUG00000000535 transcript:ENSMMUT00000000779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSEWDVLLKDVQCSIISVTKTDKQEAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLK
LARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDC
WYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGS
VIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFK
PGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
Download sequence
Identical sequences ENSMMUP00000000721 9544.ENSMMUP00000000721 ENSMMUP00000000721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]