SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000733 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000733
Domain Number 1 Region: 1438-1659
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.28e-81
Family Fibrinogen C-terminal domain-like 0.00000154
Further Details:      
 
Domain Number 2 Region: 1090-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-20
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 3 Region: 1267-1426
Classification Level Classification E-value
Superfamily Fibronectin type III 5.11e-19
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 4 Region: 733-819
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-18
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 5 Region: 465-553
Classification Level Classification E-value
Superfamily Fibronectin type III 7.54e-18
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 6 Region: 906-992
Classification Level Classification E-value
Superfamily Fibronectin type III 1.59e-17
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 7 Region: 382-465
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000019
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 8 Region: 110-195
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000321
Family Fibronectin type III 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000733
Domain Number - Region: 83-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 20-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 51-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0179
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000733   Gene: ENSMMUG00000000545   Transcript: ENSMMUT00000000791
Sequence length 1672
Comment pep:known chromosome:MMUL_1:1:204700301:204758605:1 gene:ENSMMUG00000000545 transcript:ENSMMUT00000000791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CHCEEGREGPACEQLACPGACSGHGRCVDGRCLCHEPYVGADCGYPACPENCSGHGECVR
GVCQCHEDFTSEDCSERRCPGDCSGHGFCDTGECYCEEGFTGLDCAQVVAPQGLQLLKST
EESLLVSWEPSSQVDHYFLNYYPLGKELSGKQIRVPKEQHSYEILGLLPGTKYIVTLRNV
KKDIFSSPQHLLATTDLLPPSCPKLLGTLLQASSHVYYSPLDLSFSWPGWRHLQGGEGGG
VTDEGGKPENSGGLGFPVPNLEGQAPSAWDVAVGIQTAPQRPQSSHPLERAGRTLRWTEL
KFTYFIVLPRLKSGPLVQGCSSLSSGLSDLGGQPERYSLGLTKVSVDREDHMASESQNLC
SSPLSLASLTPALDLAALGTAWVTEETEHSLDVEWENPSTEVDYYKLRYGPMTGQEVTEV
TVPKSSDPKSRYDITGLHPGTEYKITVVPMRGTLEGKPILLNGRTEIDSPTNVVTDRVTE
DTATVSWKPVQAVIDKYVVRYTSADGDTKEMAVHKDESSTVLTGLKPGEAYKVYVWAERG
NQGSKKADTNALTGGHCSPGISSFVCRSGEEGCKTNFDFHNYVFFSFLTSNKRDQPFHSM
QKVILISCEGSLTSPSHSAQFVPVGVLGLCWDIAQPFFLLKSSPGASLNLEQPDPGAHMR
FQNTWQEIRVTEYRDSGAEKILTVRMFETEEVGIEKNLPFSLAGIVEAAYAEAKVRSISR
GFYGRPLSLKEIDSPANLVTDRVTENTATISWDPVQATIDKYVVHYTSADNQETREVPVG
KEQSSTVLTGLRPGVEYTVHVWAQKGDRESKKANTNAPTGNKREMMKERLSSRGDGSGLL
FPDSDELFMRPLGPLEGKRNPKRHGSCLIGGCDVPCASEKTSFLPHFSFRTKGYFLLRLP
AETQDIDSPKNLVTDRVTENMATVSWDPVQATIDKYMVRYTSADGETREVPVGKEHSSTI
LTGLRPGMEYMVHVWAQKGDQESKKTDTKAQTGRNNNSVSLAKNKQISISHPFIFGVAGR
GKGENCWSAKGHKTVVDLALTMVPQKITFVMNYLEQRNDISVLKYRSKVKQFAQSHKNKL
VSYEISYNIDSPQNLVTDWVTENMATVSWDPVQATIDRYVVRYTSAKDGETREVPVGKEQ
NSTVLTGLRPGVEYTVHVWAQKGAQESKKADTKAQTDIDSPKNLVTDRVTENTATVSWDL
VQATIDRYVVRYTSANGETREVPVGKEQSSTVLTGLRPGVEYTVHVWAQKGNQESKKADT
KAQTEIDSPKNLVTDWVTENMATVSWDPVQATIDKYVVRYTSADGDTREVPVGKEHSSTV
LTGLRPGMEYMVHVWAQKGDQESKKADTKAQTEIDPPRNLRPSAVTQSGGVLTWTPPSAQ
IHGYILTYQFPDGTVKEIQLGREDQRFELQGLEQGATYPVSLVAFKGGLRSRNVSTTLST
VGARFPHPSDCSQVQQNSNAASGLYTIYLHGDSSRPLQVYCDMDTDGGGWIVFQRRNTGQ
LDFFKRWRTYVEGFGDPTKEFWLGLDKLHNLTTGTPTRYEVRVDLQTANESAYAIYDFFQ
VASSKERYKLTVGKYRGTAGDALSYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHL
ANPNGRYGETKHSEGVNWEPWKGHEFSIPYVELKIRPHGYSKEPVLGRKKRT
Download sequence
Identical sequences 9544.ENSMMUP00000000733 ENSMMUP00000000733 ENSMMUP00000000733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]