SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000812 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000812
Domain Number 1 Region: 39-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.02e-30
Family PDI-like 0.00018
Further Details:      
 
Domain Number 2 Region: 375-494
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.41e-29
Family PDI-like 0.0022
Further Details:      
 
Domain Number 3 Region: 252-385
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.11e-22
Family PDI-like 0.029
Further Details:      
 
Domain Number 4 Region: 161-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000582
Family PDI-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000812   Gene: ENSMMUG00000000604   Transcript: ENSMMUT00000000874
Sequence length 524
Comment pep:known chromosome:MMUL_1:20:260621:264871:1 gene:ENSMMUG00000000604 transcript:ENSMMUT00000000874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHQLLPVLLLLLRASCPWGQEQGPKSPSEEPPEEEIPKEDGILVLSRHTLGLALREHPA
LLVEFYAPWCGHCKALAPEYSKAAALLAAESTAVTLSKVDGPAQPELAEEFGVTEYPTLK
FFRNGNRTHPEEYTGPREAEGIAEWLRRRVGPSAMRLEDEAAAQALIDGRDLVVIGFFQD
LQDEDVATFLALARDALDMTFGLTDRPRLFEQFGLTKDTVVLFKKFDEGRADFPVDEELG
LDLGDLSRFLVTHSMHLVTEFNSQTSPKIFAARILNHLLLFVNQTLAAHRELLAGFGEAA
PHFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRFINVETTKKYAPVDGGPVTAASVT
AFCDAVLNGQVKPYLLSQEVPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHC
KEMAPAWEALAEKYQDHEDIIIAQLDATANELDAFAVHSFPTLKYFPAGPGRKVIEYKSA
RDLETLSKFLDNGGAVPTEEPTEEPAAPFPEPRANSTVGSKEEL
Download sequence
Identical sequences I2CUR8
NP_001252974.1.72884 9544.ENSMMUP00000000812 ENSMMUP00000000812 ENSMMUP00000000812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]