SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000879 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000879
Domain Number 1 Region: 124-222
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-28
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 2 Region: 424-617
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-25
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 219-318
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000218
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 336-411
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000193
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000879   Gene: ENSMMUG00000000651   Transcript: ENSMMUT00000000941
Sequence length 863
Comment pep:known chromosome:MMUL_1:1:70103634:70183019:1 gene:ENSMMUG00000000651 transcript:ENSMMUT00000000941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHTFRRCSLALIFITMWLLIKAKIDECKRGDVTVKPSRVILLGSTVNISCSLKPRQGCS
PYSRRNKLILYKFDRRINFHHGHSLNAQVTGLPLGTTLFVCKLACINSDEIQICGAEILV
GVAPEQPQNLSCIQKGEQGTVACTWERGQDTHLYTEYTLQLSGPKNLTWQKQCKDHYCDY
LDFGINLTPESPESNFTAKVTAVNSLGSSSSFPSTFTFLDIVRPLPPWDIRIKFQKASSV
SRCTLYWRDEGLVLLNRLRYRPSNSRHWNMVNVTEARGRHDLLDLKPFTEYEFQISSKLH
LYKGSWSDWSETLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILH
YQVTLQELTGGKVMTQNITGHTSWTTVISRTGNWAVAVSAANSKGNSLPTRINIMNLCEA
GLLAPHQVSANSESMDSILVTWQPPRKDLSAVQEYVVEWRQLHPGDDTQIPLNWLRSPPY
NVSALISENIKPYTCYEIRVYALSEDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILI
SWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMT
ALTAAGESSQGNEREFCLQGKANWMAFVAPSICVAIIMVGIFSTHYFQQKLSVFLAALRP
QWCSREIPDPANSTCTKKYPTAEEKTQLPLDRLLIDWSMPEDPEPLVISEVFHQVTPIVR
RPHCSNWPQRGKGIQGHQASEKDMMHSASSPPPPRALPAESRQLVDLYKVLESRGSYPKP
ENPASPWTVLPAGNLPTHDGYLPSNIDDLPSHEVPLTDSLEELEPQHISLSVFPSSSLHP
LTFSYGDKLTLDQLKMRCDSLML
Download sequence
Identical sequences ENSMMUP00000000879 9544.ENSMMUP00000000879 ENSMMUP00000000879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]