SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000889 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000889
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily L domain-like 4.95e-31
Family Ngr ectodomain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 257-348
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000971
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 431-500
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000125
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000889   Gene: ENSMMUG00000000660   Transcript: ENSMMUT00000000951
Sequence length 623
Comment pep:known chromosome:MMUL_1:9:53043944:53053981:1 gene:ENSMMUG00000000660 transcript:ENSMMUT00000000951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVALGMLWLLALGWPPQARGFCPSQCSCSLHIMGDGSKARTVVCNDPDMTLPPASIPPD
TSRLRLERTAIRRVPAEAFRPLGRLEQLWLPYNALSELNALMLRGLRRLRELRLPGNRLA
TFPWAALRDAPELRLLDLQANRLSAVPPEAARFLENLTFLDLSSNQLMRLPQELIISWAH
LKTGIFPHSHHPRLVLGLQDNPWACDCQLYDLVHLLDGWAPNLAFIETELRCASPRSLAG
VAFSQLELRKCQGPELHPGVANIRSPLGGTALLRCGATGVPGPEMSWRRANGRPLNGTVH
EEVSSDGTSWTLLGLPAVSHLDSGDYICQAKNFLGASETVISLIVTEPQTSTEHSGSPGA
LWARTGGGGEAAAYNNKLVARHVPQIPKPAVLATGPSVPSSKEELTLQHFQMDALGELSD
GRVGPSEARVVRSVKVVGDTYHSVSLVWKAPKAKNTTAFNVLYAVFGQHSMRRVIVQPGK
TRVTITGLLPKTKYVACVCVQGLVPRKEQCVIFSTNEVVDAENTQQLINVVVISVAVVIA
LPLTLLVCCGALQRRCRKCFNRDSTEATVTYINLERLGHSEDGLEELSRHSVSEADRLLS
ARSSVDFQAFGVKGGRRINEYFC
Download sequence
Identical sequences A0A2K6BRT8 G7N212 G7PEW5
ENSMMUP00000000889 9544.ENSMMUP00000000889 ENSMMUP00000000889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]