SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000964 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000964
Domain Number 1 Region: 157-513
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 5.89e-102
Family Inosine monophosphate dehydrogenase (IMPDH) 0.000000000327
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 1.65e-26
Family Inosine monophosphate dehydrogenase (IMPDH) 0.00000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000964   Gene: ENSMMUG00000000710   Transcript: ENSMMUT00000001027
Sequence length 513
Comment pep:known chromosome:MMUL_1:X:38102796:38104337:-1 gene:ENSMMUG00000000710 transcript:ENSMMUT00000001027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYLISGGTLYVPEDGLTAQQLFASADGLTYDDFLILPGFIDFLTGEVDLTSALTRKIT
LKTPLISFPTDTVTEADMAIAMALMGGIGFIHHNCTPEFQANKVQKVKKFEQGFITDPVV
LSPSHTVGDVLEAKVRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMT
PRIELVVAPAGVTFEEANEILKRSKKGKLPVVNDHDELVAIIARTNLKKNRDYPLASKDS
HKQLLCGAVVGTREDDKFRLDLLTQAGVDVIVLDSSQGNLVYQIAMVHYTKQKYPHLQVI
GGNVVTAAQAKNLIDAGVDGLHVGMGCGSICITPEVMACGRIHGSAVYKVAEYARRFGVP
IIADGGIQTLGHVVKALALGASTVMMGSLLAATTEASAEYFSDGVPLKKYQGMGSLDAME
KSSSSQKRYFSEGDKVKFAQSISGSIRDKGFIQKFVPYLIAGIQHSCQDIGARSLSVLRS
MMYSGELKFEKRTVSAQMEGGVHGLHSYEKRLY
Download sequence
Identical sequences 9544.ENSMMUP00000000964 XP_001085393.1.72884 ENSMMUP00000000964 ENSMMUP00000000964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]