SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001258 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001258
Domain Number 1 Region: 183-280
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-25
Family Reprolysin-like 0.0081
Further Details:      
 
Domain Number 2 Region: 378-432
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000275
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 740-800
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000085
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 1073-1124
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 1289-1400
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000366
Family Spermadhesin, CUB domain 0.014
Further Details:      
 
Domain Number 6 Region: 944-1008
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000107
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 7 Region: 1183-1268
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000222
Family Spermadhesin, CUB domain 0.009
Further Details:      
 
Domain Number 8 Region: 1014-1060
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000301
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001258
Domain Number - Region: 679-738
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000445
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Domain Number - Region: 898-947
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0405
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001258   Gene: ENSMMUG00000000937   Transcript: ENSMMUT00000001339
Sequence length 1421
Comment pep:known chromosome:MMUL_1:15:5085009:5122808:-1 gene:ENSMMUG00000000937 transcript:ENSMMUT00000001339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQRHPRARCPSLCVAGILACGFLLGCWGLSHFQQSFLQALEPQAVSSYLSSGAPLKGTC
PGVSSPREVSQDFQGLAGFQELLGFLAVDVNIYSFWQGPPCDLVLCGLGQMHTDQCLGPS
SRGGGCSRCCLEDNEGWPGPASQETTGLHLCSAAPSASALCKGDPGAATDCFLSPRFDLE
LPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGSGCGP
SGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGRHPEAQPGLY
YSANEQCRVAFGPKAVACTFSREHLDMCQALSCHTDPLDQSSCSRLLVPLLDGTECGVEK
WCSKGRCRSLVELTPIAAVHGHWSSWGPQSPCSRSCGGGVVTRRRQCNNPRPAFGGRACV
GADLQAEMCNTQVAYACTLSTLGGQSGGSGGEPLHSSPGGASFYHWGAAVPHSQGDALCR
HMCRAVGESFIMKRGDSFLDGTRCVPSGPQEDGTLSLCVSGSCRTFGCDGRMDSQQVRDV
CQVCGGDNSTCSPRNGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAVRIGGRYV
VAGKTSISSNTTYPSLLEDGRVEYRVALTKDRLPHLEEIRIWGPLQEDAEIQVYRRYGEE
YGNLTCPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKELVETARC
QGSQQPPAWPEACMLEPCPPYWAVGDFGPCSVSCGGGLRERPVRCVEAQGSLLKTLPPAR
CTAGAQQPAVAVEICNPQPCPARWEVSEPGPCTSASGAGPALQNETCVPGADGLEAPATE
GPDSVDEKLPAPEPCVGMSCPAGWGHLDATSAGEEAPSPWGSIRMGAQAAHVWTPLAGPC
SVSCGRGLMELRFLCMDAALRVPVQEELCGLASKPGSRREVCQAVPCPARWQYKLAACSV
SCGGGVMRRILYCARAHGEDEEEEILLDTQCQGLPRPDPQEACSLEPCPPRWKVMSLGPC
SASCGLGTARRSVACVQLDQQDVQVDEAACAALERAGSTLTCLPACTKIILDHSWPVCSV
SCGDGIQRRHDTCLGPQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPNLVPHEEATA
PGQTTATPAGASLEWSQAPALLFSPAPQPRRLLPGPQESSAQSSACGRQHLEPTGTIDMR
GPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRKLLGMTFSSKT
NTLVVKQRCRQPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATSKAGGCR
LFINVAPHARIAIHALATNMDNGTKGANASYISIRDIHSLRTTTFHGQQVLYWESESSQA
EMEFSEDFLKAQASLRGQYWTLQSWVPEGQDPQSWKGKEGT
Download sequence
Identical sequences ENSMMUP00000001258 9544.ENSMMUP00000001258 ENSMMUP00000001258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]