SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001388 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001388
Domain Number 1 Region: 167-448
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.48e-79
Family Eukaryotic proteases 0.000000011
Further Details:      
 
Domain Number 2 Region: 102-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000142
Family EGF-type module 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001388   Gene: ENSMMUG00000001036   Transcript: ENSMMUT00000001477
Sequence length 462
Comment pep:known chromosome:MMUL_1:17:93229086:93240551:1 gene:ENSMMUG00000001036 transcript:ENSMMUT00000001477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRALGLLCLLLGLQGCLAAGGVAEASGGEQDLLWKPGPHRGRLTQDTSHGALHTHRSP
HIRHLTLSTLHTRDTSHSGSPTPARGLSSAHRWKLFWISYSDGDQCASNPCQNGGSCKDQ
LQSYICFCLPSFEGRNCEKNKDDQLICVNENGGCEQYCSDHAGAKRSCWCHEGYSLLADG
VSCMPTVEYPCGKIPILEKRNASKPQGRIVGGRVCPKGECPWQVLLLVNGAQLCGGTLIN
TIWVVSAAHCFDKIKSWRNLTAVLGEHDLSEHEGDEQSRRVAQVIIPSTYVLGATNHDIA
LLRLQQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMALNVPR
LMTQDCLQQSQKAEASPNITEYMFCAGYSDGSRDSCKGDSGGPHATRYRGTWYLTGIVSW
GQGCAAVGHFGVYTRVSQYIEWLQKLMHSEPRPGVLLRAPFP
Download sequence
Identical sequences ENSMMUP00000001388 ENSMMUP00000001388 9544.ENSMMUP00000001388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]