SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001601 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001601
Domain Number 1 Region: 37-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000721
Family Ovomucoid domain III-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001601   Gene: ENSMMUG00000001198   Transcript: ENSMMUT00000001697
Sequence length 97
Comment pep:known chromosome:MMUL_1:6:144599489:144605414:1 gene:ENSMMUG00000001198 transcript:ENSMMUT00000001697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSFPLVSLLPFVLIHLVLSSVSGPRHWWPPHGIIKVKCPYEKVNLSWYNGTVNPCPGL
YQPICGTNFITYDNPRILCVESLKSHGRIRFYHDGKC
Download sequence
Identical sequences ENSMMUP00000001601 ENSMMUP00000001601 9544.ENSMMUP00000001601 XP_001096505.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]