SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001615 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001615
Domain Number 1 Region: 17-133
Classification Level Classification E-value
Superfamily ISP domain 1.96e-25
Family Rieske iron-sulfur protein (ISP) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001615   Gene: ENSMMUG00000001212   Transcript: ENSMMUT00000001714
Sequence length 158
Comment pep:known chromosome:MMUL_1:6:91872388:91877420:1 gene:ENSMMUG00000001212 transcript:ENSMMUT00000001714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLDGSAQDPKKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHS
GGPLHLGDIEDFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGVKQRIH
TVTVDNGNIYVTLSSEPFKCDSDFYATGDFKVIKSSSR
Download sequence
Identical sequences G7MVB1
XP_001093050.1.72884 XP_014995941.1.72884 XP_014995942.1.72884 XP_014995943.1.72884 XP_014995944.1.72884 ENSMMUP00000001615 9544.ENSMMUP00000001615 ENSMMUP00000001615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]