SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001785 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001785
Domain Number 1 Region: 50-148
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-32
Family Fibronectin type III 0.00000184
Further Details:      
 
Domain Number 2 Region: 149-252
Classification Level Classification E-value
Superfamily Fibronectin type III 4.24e-19
Family Fibronectin type III 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001785   Gene: ENSMMUG00000001336   Transcript: ENSMMUT00000001890
Sequence length 638
Comment pep:known chromosome:MMUL_1:6:42442876:42628212:1 gene:ENSMMUG00000001336 transcript:ENSMMUT00000001890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLWQLLLTLALAGSSDAFSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTS
VWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPPN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVRVRSKRRNSRNY
GEFSEVLYVTLPQMNQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGINPDLLKEGKLEEVNAILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKNEGS
DTDRLLSSDHQKSHSNLGVKDGDSGRTSCYEPDILETDFNANNIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNKSPYHDACPATQQPSVIQAEKNKPQPLPTDGAESTHQAAHIQLSNPSS
LANIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHLEMVSLCQEDFIMDNAYFCEADA
KKCIPVAPHIKVESHIEPSFNQEDIYITTESLTTTAGRPGTTEHIPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPGKEFLSSCGYVSTDQLNKIMP
Download sequence
Identical sequences A0A1D5RFI9
XP_014995445.1.72884 XP_014995446.1.72884 ENSMMUP00000001785 9544.ENSMMUP00000001785 ENSMMUP00000001785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]