SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002083 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000002083
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000294
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002083   Gene: ENSMMUG00000001560   Transcript: ENSMMUT00000002205
Sequence length 423
Comment pep:known chromosome:MMUL_1:3:103055173:103073346:-1 gene:ENSMMUG00000001560 transcript:ENSMMUT00000002205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQSSGNNRRGWNTTSQRYSNVIQP
SSFSKSTPWGGSRDQEKPSFGSFDSGASTNRKEGFGLSENPFGSLSPDEQKDEKKLLEGI
VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQH
LINQWRNRVNELKSLNISTKVALLSDVKDGVNQAAPAFGFGSSQAATFVSPGFPVNNSSS
DNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSAISTSAPAFGFGKPEVTSAAS
FSFKSPAASSFGSPGFSGLPTSLATGSIRAPVAPAFGGGSSVAGFGSPSSHSHTAFSKPS
SDTFGNSSISTSLSASSSIFATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL
LNI
Download sequence
Identical sequences A0A096MYR7 F7G4R2 G7P0R1
NP_001253108.1.72884 XP_005550048.1.63531 9544.ENSMMUP00000002083 ENSMMUP00000002083 ENSPANP00000005087 ENSMMUP00000002083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]