SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002150 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002150
Domain Number 1 Region: 543-732
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 336-522
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-16
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 3 Region: 228-324
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000113
Family Fibronectin type III 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002150
Domain Number - Region: 150-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0926
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002150   Gene: ENSMMUG00000001609   Transcript: ENSMMUT00000002274
Sequence length 977
Comment pep:known chromosome:MMUL_1:6:38669726:38764831:1 gene:ENSMMUG00000001609 transcript:ENSMMUT00000002274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFVVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSIHQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVVWVGNYSTPVKWNQVLHWSWESELPLECATHFVRIKSVIDD
ASFPEPNFWSNWSSWEEVSVQDYLGRGTLFVFPKDKLVEEGSNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNRGTNIYCEASQGNVSKGIEGIVLFVSKVLEEP
KDFSCESQDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQEMYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSMRN
NFTYLCQIELHGEGKMMQYDVSINVNGEYFLSELEPATEYMARVRCADASHFWKWTEWSG
QNFTTLEAAPSEAPDVWRSVNSEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSR
SELRSIPAPANSTKLILDRCSYQICVTANNSVGASPASIIVISADPENKEVEEERIAGTE
GGFSLSWKPQPGDVIGYVVDWCDHPQDVLQWKNVGPNTTSTVISTDAFRPGVRYDFRIYG
LSTKRIACLLEKKTGYSQELAPSDNPHVLVDMLTSHSFTLSWKDYSTESQPGFIQGYHVY
LKSKARQCHPRFQKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFVTPFTSAGEG
PNATFTKVTTPDEHSSMLIRILLPMVFCVLLIMIVCYLKSQWIKETCYPDIPDPYKSSIL
SLIKFKENPHLTIMNVSDCIPDAIEVVSKPEGTKIQLLGTRKSLTETELTKPNYLYLLPT
EKNHSGPGPCICFENFTYNQAASDAGSCGHVPVPPKAPPSMLGLMTSPENVLKALEKNYM
NSLGEVPAGETSLNYVSQLASPMSGDKDSLPTNPVEPPHCSEYKMQMAVPLRLALPPPTE
NSSLSSITLLDPGEHYR
Download sequence
Identical sequences A0A2K5UFW5 F7GUY2
ENSMMUP00000002150 XP_001083745.1.72884 XP_005556828.1.63531 XP_005556829.1.63531 XP_014995425.1.72884 ENSMMUP00000002150 9544.ENSMMUP00000002150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]