SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002326 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002326
Domain Number 1 Region: 40-127,172-300,333-448,538-640
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.62e-33
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 
Domain Number 2 Region: 469-503
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000061
Family Ovomucoid domain III-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002326   Gene: ENSMMUG00000001740   Transcript: ENSMMUT00000002460
Sequence length 710
Comment pep:known chromosome:MMUL_1:7:71702434:72013982:1 gene:ENSMMUG00000001740 transcript:ENSMMUT00000002460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYL
VSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGA
LLSALPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGSDEGPDPDLICRNRTATNMMYLLL
IGAQVLLGIGATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIY
VDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPHSDPAMESE
QAMLPEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIILAACM
EIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGA
IRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVPYGNNTAPGSALDPYSPCNNNCECQTD
SFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPSPGCQEAFLTFL
CVMCICSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAGIDST
CLFWSTFCGEQGACVLYDNVVYRYLYVSIAIALKSFAFILYTTTWQCLRKNYKRYIKNHE
GGLSTSEFFASTLTLDNLGRDPVPANQTHRTKFIYNLEDHEWCENMESVL
Download sequence
Identical sequences F7GM07
ENSMMUP00000002326 9544.ENSMMUP00000002326 ENSMMUP00000002326 XP_005560603.1.63531 XP_007988668.1.81039 XP_011735583.1.29376 XP_011933119.1.92194 XP_014998543.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]