SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002460 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002460
Domain Number 1 Region: 126-225
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-18
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 2 Region: 239-331
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000825
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002460
Domain Number - Region: 30-82
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00236
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002460   Gene: ENSMMUG00000001849   Transcript: ENSMMUT00000002606
Sequence length 420
Comment pep:known chromosome:MMUL_1:2:57917396:57938819:1 gene:ENSMMUG00000001849 transcript:ENSMMUT00000002606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIMAPVLLILLGATEILQADLLPDDKISLLPPVNFTIKVTGLAQVLLRWEPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQKDHSLLASSWASAELHA
PPGSPGTSVVNLTCTTNTTADNYSYLRPYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDSMGRNIACWFPRTFIHSRGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQIN
PPLNVTAEIKGTRLSIQWEKPVSAFPIHCFDYEVKIHNARNGYLQIEKMMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGKDEHKPLRQWFLIVLMATICFILLILLL
ICRICHLWIKLFPPIPAPKSNIKDLFVTANYEKAGSVETEIEVISYIEKPGVETLEDSVF
Download sequence
Identical sequences A0A1D5Q7M2 C3VEW9
NP_001274656.1.63531 ENSMMUP00000002460 ENSMMUP00000002467 9544.ENSMMUP00000002467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]