SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002660 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002660
Domain Number 1 Region: 8-140
Classification Level Classification E-value
Superfamily HRDC-like 9.59e-45
Family RNA polymerase II subunit RBP4 (RpoF) 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002660   Gene: ENSMMUG00000001989   Transcript: ENSMMUT00000002816
Sequence length 142
Comment pep:known chromosome:MMUL_1:13:134314375:134323159:-1 gene:ENSMMUG00000001989 transcript:ENSMMUT00000002816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGGDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
Download sequence
Identical sequences A0A096NRL5 A0A0D9RWC3 A0A2K5MNB7 A0A2K5Z612 A0A2K6CJL0 F6V9J1 G7PLH0
NP_001254716.1.72884 XP_005572910.1.63531 XP_007962784.1.81039 XP_011757783.1.29376 XP_011835886.1.47321 XP_011929136.1.92194 ENSMMUP00000002660 9544.ENSMMUP00000002660 ENSMMUP00000002660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]