SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003126 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003126
Domain Number 1 Region: 56-164
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-37
Family Third domain of FERM 0.00000131
Further Details:      
 
Domain Number 2 Region: 204-291,345-418
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-29
Family Protein kinases, catalytic subunit 0.0000022
Further Details:      
 
Domain Number 3 Region: 1-55
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000164
Family Second domain of FERM 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003126   Gene: ENSMMUG00000002336   Transcript: ENSMMUT00000003311
Sequence length 424
Comment pep:known chromosome:MMUL_1:8:143231867:143334573:-1 gene:ENSMMUG00000002336 transcript:ENSMMUT00000003311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECF
KCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQL
KIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFIIRPQKEGERALPSIPKLAN
SEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQ
GVYMSPENPALAVAIKTCKNCTSDSVREKFLQEACRLMYISFILWYLCHYTSLHWNWCRY
ISDPNLDCPDSGNVEVSMTHAVPALMELIDYHSNIIKNALKTALLLNLRSFLQVRKYSLD
LASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKG
KKSG
Download sequence
Identical sequences ENSMMUP00000003126 ENSMMUP00000003126 9544.ENSMMUP00000003126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]