SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003355 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003355
Domain Number 1 Region: 33-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.25e-88
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 281-403
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-32
Family Spectrin repeat 0.000000765
Further Details:      
 
Domain Number 3 Region: 517-638
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-31
Family Spectrin repeat 0.00000436
Further Details:      
 
Domain Number 4 Region: 398-513
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-24
Family Spectrin repeat 0.00000178
Further Details:      
 
Domain Number 5 Region: 746-873
Classification Level Classification E-value
Superfamily EF-hand 6.08e-22
Family Calmodulin-like 0.093
Further Details:      
 
Domain Number 6 Region: 642-753
Classification Level Classification E-value
Superfamily Spectrin repeat 1.39e-19
Family Spectrin repeat 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003355   Gene: ENSMMUG00000002494   Transcript: ENSMMUT00000003550
Sequence length 901
Comment pep:known chromosome:MMUL_1:14:7894122:7909713:-1 gene:ENSMMUG00000002494 transcript:ENSMMUT00000003550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMVMQPEGLGAREGPFAGSGGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLR
KAGTQIENIEDDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVK
LVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNV
QNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAED
IVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASEL
LEWIRRTIPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLR
LSHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFRQKASLH
EAWTRGKEEMLSQRDYDSASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDY
HEAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLD
GAVEDLQDVWLVHSVEETQSLLTAHDQFKATLPEADRERGAIMGIQGEIQKICQTYGLRP
CSTNPYITLSPQDINTKWDMVRKLVPSRDQTLQEELARQQVNERLRRQFAAQANAIGPWI
QAKVEEVGRLAAGLAGSLEEQMAGLRQQEQNIINYKTNIDRLEGDHQLLQESLVFDNKHT
VYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMM
EPDDFRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVA
SFKILAGDKNYITPEELRRELPAEQAEYCIRRMVPYKGSGAPAGALDYVAFSSALYGESD
L
Download sequence
Identical sequences A0A1D5RDS4 A0A2K5VIN2
9544.ENSMMUP00000003355 ENSMMUP00000003355 XP_001109839.1.72884 XP_005577206.1.63531 ENSMMUP00000003355 ENSPANP00000012089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]