SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003559 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003559
Domain Number 1 Region: 199-234,328-641
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.8e-41
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 
Domain Number 2 Region: 14-235,276-366
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.3e-20
Family WD40-repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003559   Gene: ENSMMUG00000002642   Transcript: ENSMMUT00000003766
Sequence length 698
Comment pep:known chromosome:MMUL_1:1:46091997:46124485:1 gene:ENSMMUG00000002642 transcript:ENSMMUT00000003766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVVAQTLHVFGLRSHVANNIFYFDEQIIIFPSGNHCVKYNVDQKWQKFIPGSDKSQGM
LALSISPNRRYLAISETVQEKPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSK
YLLAQTSPPESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSPQDNTQVCVTGNGMFKLL
RFTEGTLKQTNFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPT
RDSKNLDVIQESESLIEFPPISSPLPSYEQMVAASSHSQLSMPQVFAIAAYSKGFACSAG
PGRVLLFEKMEEKDFYRESREIRIPVDPQSNDPSQSDKQDVLCLCFSPSEETLVASTSKN
QLYSITMSLTEISKGEPAHFEYLMYPLHSAPITGLATCIRKPLIATCSLDRSIRIWNYET
NTLELFKEYQEEAYSISLHPSGHFIVVGFADKLRLMNLLIDDIRSFKEYSVRGCRECSFS
NGGHLFAAVNGNVIHVYTTTNLENISSLKGHTGKIRSIVWNADDSKLISGGTDGAVYEWN
LSTGKRETECVLKSCSYNCVTVSPDAKIIFAVGSDHTLKEIADSSILREISAFDVTYTTI
VISHSGRMMFVGTSVGTIRAMKYPLPLQKEFNEYQAHAGPITKVSRALSPGTQSHTCLPH
ALFVPSTSQCLFSLLSLSYLFIHHSLNHWLLTMNILFV
Download sequence
Identical sequences ENSMMUP00000003559 ENSMMUP00000003559 9544.ENSMMUP00000003559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]