SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003829 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003829
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.47e-46
Family Galectin (animal S-lectin) 0.000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003829   Gene: ENSMMUG00000002866   Transcript: ENSMMUT00000004056
Sequence length 132
Comment pep:known chromosome:MMUL_1:10:81481445:81491543:-1 gene:ENSMMUG00000002866 transcript:ENSMMUT00000004056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGELEVKNMDMKPGSTLKITGRIADGADGFVINLGQGTDKLNLHFNPRFSESTIVCNSL
DGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVR
GGFNTSSFKLKE
Download sequence
Identical sequences A0A2K5YES6 A0A2K6E1W0 F7HHW0
ENSMMUP00000003829 ENSMMUP00000003829 XP_001087063.1.72884 XP_011710736.1.29376 XP_011834297.1.47321 9544.ENSMMUP00000003829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]