SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003888 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003888
Domain Number 1 Region: 85-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-31
Family Laminin G-like module 0.0000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003888   Gene: ENSMMUG00000002905   Transcript: ENSMMUT00000004121
Sequence length 440
Comment pep:known chromosome:MMUL_1:13:50103131:50538489:-1 gene:ENSMMUG00000002905 transcript:ENSMMUT00000004121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQRMLRCGAELGSPGVGGGGGGGAGGRLALLWIVPLTLSGLLGVAWGASSLGAHHIHHF
HGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFS
TVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRF
TRSGGNATLQVDSWPVIERYPAGKQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKV
LNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGK
PPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRES
SSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQ
PSSAKSANKNKKNKDKEYYV
Download sequence
Identical sequences 9544.ENSMMUP00000003888 ENSMMUP00000003888 ENSMMUP00000003888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]