SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004046 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004046
Domain Number 1 Region: 37-113
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 116-195
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004046   Gene: ENSMMUG00000003032   Transcript: ENSMMUT00000004291
Sequence length 377
Comment pep:known chromosome:MMUL_1:13:115936197:115937397:1 gene:ENSMMUG00000003032 transcript:ENSMMUT00000004291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VETEQPEETFPNTETSGEFGKRPAEDMEEEQIFKRPGNTDEMVGLHILLQSKNAGAVIGK
GSKNIKALPTDYNASVSIPDSSGPKPILSISADIETIGEIIRKIIHTLEEDYQHHKGSDF
DCVLRLLIHQSLAAGITGVKDAKIKELRNTQPTITLFQECCPHSTDRVILIGGKPDRVVE
CIKIILDLISESPIKGHAQPYDPNFYDETYDYGGFTMVFDDRRGRPVGFLMQGRGGFDRM
PPGRSGRPMPPSRRNYDDMSARQGPPSPPPGQDGWGGSRARNLPLPPPPRGGDLMTYNRK
GRPGDRYVGMVDFSADETWDSAVDPWSTSEWQMAYEPQGGSKYDYSYAGGRGSYGDLGGP
IITTQVTIPKDLSGSII
Download sequence
Identical sequences ENSMMUP00000004046 9544.ENSMMUP00000004046 ENSMMUP00000004046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]