SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004194 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004194
Domain Number 1 Region: 178-373
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.61e-51
Family Reprolysin-like 0.00018
Further Details:      
 
Domain Number 2 Region: 393-471
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.45e-21
Family Blood coagulation inhibitor (disintegrin) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004194   Gene: ENSMMUG00000003137   Transcript: ENSMMUT00000004445
Sequence length 735
Comment pep:known chromosome:MMUL_1:8:40290349:40403846:-1 gene:ENSMMUG00000003137 transcript:ENSMMUT00000004445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVLFLLSGLGGLWMDSNFDSLPVQITVPEKIRSIIKEEIESQVSYKIVIEGKPYTANL
MQKNFLSHNFRVYSYNGTGIMKPLDQDFQNFCHYQGYIEGYPKSVAMVSTCTGLRGLLQF
ENVSYGIEPLESSVGFEHVIYQVKHKKADVSLYNEKDIESRDLSFKLQSIEPQKDFAKYI
EMHVVVEKQLYNHMGSGTTVVTQKIFQLIGLTNAIFVSLNITVILSSLELWIDENKIATT
GDAKELLHTFLRWKRSYLVLRPHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVLLHPR
TISLESLAVILAQLLSLSMGIPYDDINQCQCSAAVCIMNPEAIHFSGVKIFSNCSIEDFA
HFISKQKSQCLHNQPRLDPFFKQQAVCGNAKLEAGEECDCGTQQNCFLLGAKCCDTATCR
FKAGSNCAEGPCCENCLFMSQERVCRPSFDECDLPEYCNGTSASCPENHFIQTGHPCGPN
QWVCIDGVCMNGDKQCMDTFGGEAEFGPTECYSYLNSKTDVSGNCGIGDSGYTQCEADNL
QCGKLICKYAGEFLLQIPRATIIYANISGHLCVAVEFASDHEDSHKMWIKDGTSCGSNKV
CKNQRCVSSSYLGYDCTTDKCNHRGVCNNKKHCHCSASYLPPDCSVQSDTSPGGSIDSGN
FPLVAVPARLPERRHMENVYYSKPMRWPLFLFIPFFIIFCVLIAIMVKVHFQRKKWRTED
YSTDEQPESESEPKG
Download sequence
Identical sequences ENSMMUP00000004194 ENSMMUP00000004194 9544.ENSMMUP00000004194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]