SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004382 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004382
Domain Number 1 Region: 20-67
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.0000595
Family ENTH domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004382   Gene: ENSMMUG00000003291   Transcript: ENSMMUT00000004648
Sequence length 523
Comment pep:known chromosome:MMUL_1:16:76683398:76696229:-1 gene:ENSMMUG00000003291 transcript:ENSMMUT00000004648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPPVRDRLSFLHRLPILLKGTSDDDVPCPGYLFEEIAKISHESPGSSQCLLEYLLSR
LHSSSGHGKLKLRLSLLSACSHGAAVPGSALPPTCLLCSAAFAGPPDPLHGNSLYQKVRA
AAQDLGSTLFSDTVLPLAPSQPLGNPPATGMGSQARPHGTLQGFGYSKEHGRTAMRHQPG
QAGGGWDELDSSPSSQNSSQNSDLSRVSDSGSHSGSDSHSGASREPGDLAERVEVVALSD
CQQELSLVRTVTRGPCAFLSREEAQHFLKACGLLNCEAVLQLLTCHLRGTSECTQLRALC
AIASLGSADLLPQEHILLRTRPRLQELSMGSPGPVTNKATKILRHFEASCGQLSPARGTS
AEPGPTAALPGPSDLLTDAVPLAGSQLFLQPLSSTAVSCRSPAPSSGMPPSPVPTPPPDA
SPIPARGDPSKAKARLAESRGWGPEQVLGGTDSPKSGPSDCAWSRDSLFAGMELVACPRL
VGAGAAAGESCLDAPQAPQTSSQRTAVKEPPGSEPSAFAFLNA
Download sequence
Identical sequences ENSMMUP00000004382 ENSMMUP00000004382 9544.ENSMMUP00000004382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]