SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004493 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004493
Domain Number 1 Region: 625-778
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.32e-42
Family Toll/Interleukin receptor TIR domain 0.000000481
Further Details:      
 
Domain Number 2 Region: 32-165,348-566
Classification Level Classification E-value
Superfamily L domain-like 2.21e-39
Family Ngr ectodomain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004493   Gene: ENSMMUG00000003373   Transcript: ENSMMUT00000004767
Sequence length 811
Comment pep:known chromosome:MMUL_1:5:33755520:33758755:-1 gene:ENSMMUG00000003373 transcript:ENSMMUT00000004767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLIRNIYIFCSIVMTVEGEAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLL
FQLQSSDFHSVSKLKVLILRHNRIQQLNLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLR
YLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNSVFLGFRTLSHY
EEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNISLE
NAKTSVLLLNKVDLLWDDLFHILQFVWHTSVEHFQIQNVTFGGKAYLDHNSFDYSNTVMR
TIKLEHVHFRVFYIQQDNIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL
TDELFKRTIQLPHLKTLLLNSNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP
ETVVNMNLSYNKLSDSVFRCLPKGIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTD
LPGCSHFSRLSILNVEMNLILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYS
EVMMVGWSDSYTCEYPLNLRGTRLKDVHLPELSCNTALLIVTIVVIMLVLGLAVAFCCLH
FDLPWYFRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED
GSILICLYERYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAYHNLFHE
NSDHIILILLEPIPFYCIPTRCHKLKTLLEKKAYLEWPKDRRKCGLFWANLRVAINVNIS
ATREMYELQTFTELNEESRGSTVSLMRTDCL
Download sequence
Identical sequences B3Y674
ENSMMUP00000004493 ENSMMUP00000035347 NP_001123906.1.72884 XP_014993639.1.72884 ENSMMUP00000004493 9544.ENSMMUP00000035347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]