SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004598 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004598
Domain Number 1 Region: 422-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.04e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 338-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 298-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000106
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 245-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000221
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 5 Region: 384-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000525
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004598   Gene: ENSMMUG00000003453   Transcript: ENSMMUT00000004881
Sequence length 606
Comment pep:known chromosome:MMUL_1:16:33525870:33548556:-1 gene:ENSMMUG00000003453 transcript:ENSMMUT00000004881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHTASSCQELVENCAVHVAGMAQEDSRRGQVPSSFYHGANQELDLSTKVYKRESGSPYS
VLVDTKMSKPHLHETEEQPYFRETRAVSDVHAVKEDRENSDDTEEEEEEVSYKREQIIVE
VNLNNQTLNVSKGEKGVSSQSKETPVLKTSSEEEEEESEEEATDDSNDYGENEKQKKKEK
IVEKVSVTQRRTRRAASVAAATTSPTPRTTRGRRKSVEPPKRKKRATKEPKAPVQKAKCE
EKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESELSLHQQTDCEKNIQ
CVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVAHTKDMPFTCE
TCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHIGHKQFMCQWCGK
DFNMKQYFDEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRF
SNMLKAHKEKCFRVTSPVNVPPAVQIPLTTSPATPVPSVVNTPTTPTPPINMNPVSTLPP
RPIPHPFSHLHIHPHPHHPHHLPIPPVPHLPPPPALFKSEPLNHRGQSDDSFLRHLAEKN
SSAQHH
Download sequence
Identical sequences F7F4P3 G7PU88
ENSMMUP00000004598 9544.ENSMMUP00000034905 NP_001253324.1.72884 XP_005583670.1.63531 XP_014974722.1.72884 ENSMMUP00000004598 ENSMMUP00000034905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]