SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004672 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004672
Domain Number 1 Region: 12-142,173-192
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.11e-45
Family Calponin-homology domain, CH-domain 0.0000295
Further Details:      
 
Domain Number 2 Region: 8049-8204
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8428-8542
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 7829-7953
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 3329-3451
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 6 Region: 3114-3269
Classification Level Classification E-value
Superfamily Spectrin repeat 2.98e-17
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 7 Region: 6968-7110
Classification Level Classification E-value
Superfamily Spectrin repeat 7.13e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 8 Region: 7421-7552
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 9 Region: 4503-4660
Classification Level Classification E-value
Superfamily Spectrin repeat 2.65e-16
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 6757-6897
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000537
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 3757-3878
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000054
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 12 Region: 2455-2585
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000566
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 13 Region: 4285-4441
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000662
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 14 Region: 7094-7224
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 15 Region: 7958-8067
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000806
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 16 Region: 1402-1536
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000932
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 17 Region: 2673-2799
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000108
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 18 Region: 3885-3994
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000017
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 19 Region: 554-696
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000398
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 1625-1755
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000419
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 21 Region: 3563-3695
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000624
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 22 Region: 7348-7455
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000113
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 23 Region: 7619-7769
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 24 Region: 2827-2944
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000237
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 25 Region: 8505-8651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000378
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 26 Region: 5733-5804,5915-5961
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000045
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 27 Region: 4954-5077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000131
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 28 Region: 1084-1222
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000648
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 1920-2071
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000912
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 30 Region: 1708-1861
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000197
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 31 Region: 2047-2186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000204
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 32 Region: 2244-2372
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000028
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 33 Region: 5175-5274
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000304
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 34 Region: 1512-1618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000366
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 35 Region: 4615-4768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000038
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 36 Region: 5468-5587
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000432
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 37 Region: 3456-3561
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 38 Region: 5592-5683
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000308
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 39 Region: 3028-3126
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000954
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 40 Region: 6551-6635
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000163
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 41 Region: 4202-4330
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000236
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 42 Region: 4872-4984
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000903
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 43 Region: 6375-6480
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000127
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 44 Region: 3996-4129
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000173
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 45 Region: 6074-6188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000301
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 46 Region: 5058-5140
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000368
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004672
Domain Number - Region: 2400-2468
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000391
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 6684-6794
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000533
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number - Region: 884-1003
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00177
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 4114-4219
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00707
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number - Region: 5281-5372
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004672   Gene: ENSMMUG00000019048   Transcript: ENSMMUT00000004961
Sequence length 8791
Comment pep:known chromosome:MMUL_1:4:110426748:110640908:1 gene:ENSMMUG00000019048 transcript:ENSMMUT00000004961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPS
IVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNA
KKALLKWVQYTAGNPSHLCKRTLLGRWGRASHGTKLLVRSSLRRERSDGSVEKEDSKDSE
LGVEAEGTDRRERRKIWDDKRMPGHQAPQTICPFFDKNHPGLNQSGINQQLNKCTDTNKI
IMSPCFQREDRLILKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIE
HLVQPLHRDGKLSLDQALVKQSWDRVTSRLFDWHIQLDKSLPAPLGTIGAWLYRAEVALR
EEITIQQVHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMA
ERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLLQNYVSF
IENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSVEVRSVRS
MLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSEIAKKDFFRNLPHWIQQHTAMNDAGNF
LIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCVVNLSAFATE
AHKKLCEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQYKIITKTAHLITKESPQEEGKEMF
ATMSKLKEQLTKVKECYSPLLYESQQLLIPLEELEKQMTSFYDSLGKINEIITVLEREAQ
SSALFKQKHQELLACQENCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQRQIADVHV
AFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEELLRRHTEF
FSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKVSQDRTETPLSVLRSKC
KRNLEIPGKTQDAEVAVSQDLTTVLQPGSEKIIKEHVFFSDKGPHHLCEKRLQLIEELCV
KLPVRDPVRDTPGTCHATLKELRAAIDSTYRKLMEDPDKWKDYTNRFSEFSSWISTNETQ
LKGIKGEAIDTANHREVKRAVEEIRNGVTKRGETLSWLKSRLKVLTEVSSENQAQKQGDE
LAKLSSSFKALVTLLSEVEKMVSNFGDCVQYKEIVKNSLEELISGSKEVQEQAEKILDTE
NLFEAQQLLLHHQQKTKRISAKKRDVQQQIAQAQQEEGGLPDRGREELRKLESTLDGLER
SRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELEQTKEFS
KRTENIAVQAENLVKEASEIPLGPQNKQLLQQQAQSIKEQVKKLEDTLEEDIKTMEMVKT
KWDHFGSNFETLSVWITEKEKELNALETSSSAMDMQISQIKVTIQEIESKLSSIVGLEEE
AQSFAQFVTTGESARIKAKLTQIRRYWEELREHAQCLEGTILGHLSQQQKFEENLRKIQQ
SVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSLITTFSASARKVVNRDSCV
QEAVALQHQYEDTLRRAKETQTALENLLAHWQRLEKELSSFLTWLERGEAIASSPEMDIS
ADRVKVEGELQLIQASSRKFVSQASFYSKLLQLKESLFSIASKDDVKMVKLHLEQLDERW
RDLPQIIDKRINFLQSVVAEHQQFDELLLSFSVWIKLFLSELQTTSEISIMDHQVALTRH
KDHAAEVESKKVELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQVVERRQLA
LSHLAEFLQSHASLSGILHQLRQTVEATNSMNKNESDLIEKDLNDALQDAKALESAAVSL
DGILSKAQYHLKSGSSEQRTSCRATADQLCGEVERIQNLLGTKQSEADALAVLKKAFQDQ
KEELLKSIEDIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWLKDKAKQIA
QKDVAFAPEVDREINRLAVTWDDTKRLIHENQGQCCGLIDLMREYQNLKSAVSKVLENAS
SVIVTRTTIKDQEDLKWAFSKHETAKNKMNYKQKDLDNFTSKGKHLLSELKKIHSSDFSL
VKTDMESTVDKWLDVAEKLEENMDRLRVSLSIWDDVLSSRDEIEGWSNNSVPQMAKNISN
LDNRLRAEELLKEFESEVKNKALRLEELHSKVNDLKELTKNLETPPDLQFIEADLRQKLE
HAKEITEVAKGTLKDFTAQSTQVEKFINDITTWLAKVEESLMNCAQTDTCEGLKKVKDIQ
KELQSQQSNISSTQENLNSLCRKYHSAELENLGAMTGLIKKHEVAIEVLEKTQQDIRHSR
NIHFFLSMQEFQEWFLGAKASAKESSDRTGDSKVLEAKLHDLQNLLDSVSDGQSKLDAVT
QEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCASELGSFEDQHRKL
NLWIHEMEERFNTENLGESKQHIPEMKNEVHKVEMFLGELLAARESLDKLSQRGQLLSEE
GHGAGQEGRLCSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEALQSMWSWVKAIQDRL
ACAESTLGSKDTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQRVIQTQL
ETLKEVWADIMSSSIHAQSTLESVISQWNDYLERKNQLEQWMESVDQKVEHPLQPQPGLK
EKFALLDRLQSILSEAEDHTRALHRLIAKSRELYEKTEDESFKDTAQEELKTQFNDIMTV
AKEKMRKVEEIVKDHLMYLDAVHEFTDWLHSAKEELHRWSDMSGDSSATQKKLSKIKELI
DSREIGASRLSRVESLAPEVKQNTTASGCELMHTEMQALRADWKQWEDSVFQTQSCLENL
VSQMALSEQEFSGQAAQLEQALQEFSALLKTWAQQLTLLEGKNTDEEIVECWHKGQEILD
ALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQASKGCQNKEQILQQ
RFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLSESENGQHKLNVMLSK
GELLSTLLTKEKAKGIQAKVSGAKEDWKNFHSNLHQKESALENLKIQMKDFEVSAEPIQD
WLSKTEKMVHESSNRLYDLPAKRREQQKLQSVLEEIHCYEPQLNRLKEKAQQLWEGQAAS
KSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWMTDAIHMLDSYC
HPTSDKSVLDSRTLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGIPTIQQQLQSVK
DMWASLLSAGIRCKSQLEGALSKWTSYQDDVRQFSSWMDSMEANLNESERQHAELRDKIS
MLGKAKLLNEEVLSYSSLLETIEVKGAGMTEHYVTQLELQDLQERYRAIQERAKEAVTKS
EKLVRLHQEYQRDLKAFEVWLGQEQEKLDQYSVLEGDAHTHETTLRDLQELQVYCAEGQA
LLNSVLHTREDVIPSGIPQAEDRALESLRQDWQVYQHKLSETRTQFNNVVNKLRLMEQKF
QQVDEWLKTAEEKISPRTIRQSNRATKEIQLHQMKKWHEEVTAYRDEVEEVGARAQEILD
ESHVNSRMGCQATQLTSRYQALLLQVLEQIKFLEEEIQSLEESESSLSSYSDWYGSTHKN
FKNVATKIDKVDTTMMGKKLKTLEVLLKDMEKGHSLLKSAREKGERAVKYLEEGEADRLR
KEIHDHVEQLKELTSTVRKEHMTLEKGLHLAKEFSDKCKALTQWIAEYQEILRVPEEPKM
ELYEKKAQLSKYKSLQQTVLSHEPSVKSVREKGEALLELVQDVTLKDKIDQLQSDYQDLC
SIGKEHVFSLEAKVKDHEDYNSELQEVEKWLLQMSGRLVAPDLLETSSLETITQQLAHHK
AMMEEIAGFEDRLNNLQMKGDTLIGQCADHLQAKLKQNVHAHLQGTKDSYSAICSTAQRV
YQSLEHELQKHVSRQDTLQQCQAWLSTVQPDLEPSSQPPLSRAEAVKQVKHFRALQEQAR
TYLDLLCSMCDLSNASVKTTAKDIQLTEQMIEQRLVQAQNLTQGWEEIKHLKAELWIYLQ
DADQQLQNMKRRHSELELSIAQNMVSQVKDFVKKLQSKEASVNTIIEKVNKLTKKEESPE
HKEINHLNDQWLDLCHQSNNLCLQREEDLQRTRDYHDCMNVVEVFLEKFTTEWDNLARSD
AESTAVHLEALKKLALALQERKYAIEDLKDQKQKMIEHLNLDDKELVKEQTSHLEQRWFQ
LEDLIKRKIQVSVTNLEELNVVQSRFQELMDWAEEQQPNIAEALKQSPPPDMAQNLLMDH
LAICSELEAKQMLLKSLIKDADRVMADLGLNERQVIQKALSDAQSHVNCLSDLVGQRRKY
LNKALSEKSQFLMAVFQATSQIQQHERKIMFREHICLLPDDVSKQVKTCKSAQASLKTYQ
NEVTGLWAQGRELMKGVTEQEKSEVLGKLQELQSVYDSVLQKCSHRLQELEKNLVSRKHF
KEDFDKACHWLKQADIVTFPEINLMNESTELHTQLAKYQHILEQSPEYENLLLMLQRTGQ
TILPSLNEVDHSYLSEKLNTLPQQFNVIVALAKDKFYKVQEAILARKEYASLIELTTQSL
SELEAQFSRMSKVPTDLAVEEAVALQDGCRAILDEVVGLGEAVDELNQKKEGFRSTGQPW
QPDKMLHLVTLYHRLKRQTEQRVSLLEDTTSAYQEHEKMCQQLERQLKSVKEEQSKVNEE
TLPAEEKLKMYHSLGGSLQDSAILLKRVTIHLEDLAPHLDPLAYEKARHQIQSWQEELKL
LTSAIGETVTECESRMVQSIDFQTEMSRSLDWLRRVKAELSGPVYLDLNLQDIQEEIRKI
QIHQEEVQSSLRIMNALSHKEKEKFTKAKELISADLEHSLAELSELDGDIQEALRTRQAT
LTEMFSQCQRYYQVFQAANDWLEDAQEMLQLAGNGLDVESAEENLKNHMEFFSTEDQFHS
NLEELRGLVATLDPLIKPTGKEDLEQKMASLELRSQRMSQDSCAQVDLLQRCTAQWHDYQ
KAREEVIELMNDTEKKLSEFSLLKTSSSDEAEEKLSEHKVRVLFFFFLNPFSIIDSRWKC
IAKILKRCSEQFASDKMWHLINRWTRLRAVAQDQEKILEDAVDEWTGFNNKVKKATEMID
QLQDKLPGSSAEKASKAELLTLLEYHDTFVLELEQQQSALGMLRQQALSMLQDGATPTPG
GEPPLMQEITAMQDRCLNMQEKVKTNGKLVKQELKDREMVETQINSVKCWVQETKEYLGN
PTIEIDAQLEELQILLTEATNHRQNIEKMAEEQKDKYLGLYTILPSELSLQLAEVALDLK
IRDQIQDKIKEVEQSKAMSQELSRQIQKIAKDLTTILTKLKAKTDNLVQAKTDQKVLGEE
LDGCNSKLMELDAAVQKFSEQNGQLGKPLAKKIGKLTELHQQTIRQAENRLSKLNQAASH
LEEYNEMLELILKWIEKAKVLAHGTIAWNSASQLREQYILHQTLLEESKEIHSDLEVMTE
KLQYLTSVYCTEKMSQQVAELGRETEELQQMIKIRLQNLQDAAKDMKKFEAELKKLQTAL
EQAQATLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQSALRIPEDVVASLPL
CHAALRLQEEASRLQHTAIQQCNIMQAGAVVQYEQYEQEMKHLQQLIEGAHREIEDKPVA
TSNIQELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLAEG
TEDLDGELLPAPSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVAN
TDASVNQDIAYYQALSAERLQTDAAKIHPSTSASQELYEPGLEPSATAKLGDLQRSWETL
KNVISEKQRTLYEALERQQKYQDSLQSISTKMEAIELKLSESPEPGRSPESQMAEHQVQI
AMTSVSCLNKCTLVTVWPVRHVFEIAINKSPNDELPLEILIVLLGCVLPVILMCSQGLEP
LLYYKLNDQLEEQRQEQALQRYRCEADELDSWLLSTKATLDTALGTPKEPMDMEAQLVDC
QNMLVEIEQKVVALSELSVHNENLLLEGKAHTKDEAEQLAGKLRRLKGSLLELQRALHDK
QLNMQGTAQEKEESDVDLTATQSPGVQEWLAQARTTWTHQRQSSLQQQKELEQELAEQKS
LLRSVASRGEEILIQHSAAETSGDAGEKPDVLSQELGMEGEKSSAEDQMRMKWESLHQEF
STKQKLLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDVPIQDKSAVTSLLDGLNQAFEEVS
SQSGGTKRQSIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETETCLFNQEILAKDI
KEMSEEMDKNKNLFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQRCHQMKERLQQI
LNFQNDLKVLFTSLADNKYIILQKLANVFEQPVAEQIEAIQQAEDGLKELDAGIIELKRR
GDKLQIEQPSMQELSKLQDMYDELMMTIGSRRSGLNQNLTLKSQYERALQDLADLLETGQ
EKMAGDQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLFRKIISFAVQKETQFHTEL
MAQASAVLKRAHKRGVELEYILETWSHLDEDQQELSRQLEVVENSIPSVGLVEENEDRLI
DRITLYQHLKSSLNEYQPKLYQVLDDGKRLLISISCSDLESQLNQLGERWLSNTNKVSKE
LHRLETILKHWTRYQSESADLIHWLQSAKDRLEFWTQQSVTVPQELEMVRDHLNAFLEFS
KEVDAKSSLKSSVLSTGNQLLRLKKVDTATLRSELSHIDSQWTDLLTNIPAVQEKLHQLQ
MDKLPSRHAISEVMSWISLMENVIQKDEDNIKNSIGYKAIHEYLQKYKGFKIDINCKQLT
VDFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQLLEGLLESWSE
YENNVQCLKTWFETQEKRLKQQHRIGDQASVQNALKDCQDLEDLIKAKEKEVEKIEQNGL
ALIQNKKEDVSGIVVGTLQGLGQTWASLDHMVGQLKILLKSVLDQWSNHKVAFDKINSYL
MEARYSLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQERSLQKFGSITNQLLKECHPPVT
ETLTNTLKEVNMRWNNLLEEIAEQLHSSKALLQLWQRYKDYSKQCASSVQQQEDRTNELL
KAATNKDIADDEVATWIQDCNDLLKGLGTVKDSLFVLHELGEQLKQQVDASAASALQSDQ
LSLSQHLCALEQALCKQQTSLQAGVLDYETFAKSLEALEAWIVEAEEILQGQDPSHSSDL
STIQERMEELKGQMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTTE
RFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFS
RQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQ
RYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDEVQFKEKVFLRQQGSYILTVE
AGKQLLLSADSGAEAALQAELTEIQEKWKSASVRLEEQKKKLAFLLKDWEKCEKGIADSL
EKLRTFKKKLSQCLPDHHEELHAEQMRCKELENAVGSWTDDLTQLTLLKDTLSAYISADD
ISILNERIELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEKNKELCEWLTQMESKVSQN
GDILIEEMIEKLKKDYQEEIAVAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRW
QHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKL
NEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAM
SMERRLKIEETWRLWQKFLDDYSRFEDWLKTSERTAAFPSSSGVIYTVAKEELKKFEAFQ
RQVHECLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRVTSILRRLKHF
IGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNHNKIEQI
IAQGEQLIEKSEPLDAAIIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDEHDLSDRE
LELEDSAALSDLHWHDRSADSLLSPQPSSNPSLSLAQPLRSERSGRDTPASVDSIPLEWD
HDYDLSRDLESAVSRALPSEDEESQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSR
FQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSGSIDSVKRLEHKLKEEEESLPGFVN
LHSTETQTAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLNSIWAWLGDTEEELEQL
QRLELSTDIQTIELQIKKLKELQKAVDHRKAIILSINLCSPEFTQADSKESRDLQDRLSQ
MNGRWDRVCSLLEEWRGLLQDALMQCQGFHEMSHGLLLMLENIDRRKNEIVPIDSNLDAE
ILQDHHKQLMQIKHELLESQLRVASLQDMSCQLLVNAEGTDCLEAKEKVHVIGNRLKLLL
KEVSRHIKELEKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKTPRGKCSLS
QPGPSVSSPHSRSTKGGSDSSLSEPGPDRSSRAFLFRVLRAALPLQLLLLLLIGLACLVP
MSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences 9544.ENSMMUP00000025065 ENSMMUP00000004672 ENSMMUP00000025065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]