SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004799 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004799
Domain Number 1 Region: 286-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-57
Family SPRY domain 0.00005
Further Details:      
 
Domain Number 2 Region: 72-131
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000111
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004799
Domain Number - Region: 23-47
Classification Level Classification E-value
Superfamily RING/U-box 0.0297
Family RING finger domain, C3HC4 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004799   Gene: ENSMMUG00000003598   Transcript: ENSMMUT00000005093
Sequence length 457
Comment pep:known chromosome:MMUL_1:6:177878964:177888908:-1 gene:ENSMMUG00000003598 transcript:ENSMMUT00000005093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCWERPGAGIVGAVTRAPPFPLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAAAPG
EHGSQAPSAGAAAARCGQHGEPFKLYCQDDGRAICVVCDRAREHREHAVLPLDEAVQDAK
ELLESRLRVLKKELEDYEVSRSTEEKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRL
LSRLEELSREVAQKQNENLAQLGAEITQLSKLSSQIQETAQKPDLDFLQEFKSTLSRCSN
VPGPKPTTVSSEMKNKVWNVSLKTFVLKGMLKKFKEDLRGELEKEEKVELTLDPDTANPR
LILSLDLKSVRLGERAQELPNHPRRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVA
RESVRRKGLTPFTPEEGVWALQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSF
YAVEDMRHLYTFRVNFQERVFPLFSVCSTGTYLRIWP
Download sequence
Identical sequences ENSMMUP00000004799 9544.ENSMMUP00000004799 ENSMMUP00000004799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]