SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004806 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004806
Domain Number 1 Region: 524-585
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-20
Family SPRY domain 0.00073
Further Details:      
 
Domain Number 2 Region: 318-378
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.4e-17
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 101-149
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000825
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 276-308
Classification Level Classification E-value
Superfamily RING/U-box 0.000041
Family IBR domain 0.09
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004806
Domain Number - Region: 360-483
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.068
Family Apolipoprotein A-I 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004806   Gene: ENSMMUG00000003603   Transcript: ENSMMUT00000005101
Sequence length 614
Comment pep:known chromosome:MMUL_1:6:177908399:177921199:1 gene:ENSMMUG00000003603 transcript:ENSMMUT00000005101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPRSIGADLHSEPPEGLGGGAQHCPLPSQRRGCRLGVGNTVWRGGLAGGHLSGCPWGE
VWRGRAGGGAGSPGRRWGRPPPLAPPPHLYTGWLDTKMAAVAMTPNPVQTLQEEAVCAIC
LDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELDREEEEEDGEEEEVEAVGAGAGWD
TPMRDEDYEGDMEEEVEEEEEGVFWTSGMSRSSWDNMDYVWEEEDEEEDLDYYLGDMEED
LRGEDEEDEEEVLEEDEEEDLDPVTPLPPPPAPRRCFTCPQCRKSFPRRSFRPNLQLANM
VQVIRQMHPTPGRGSRVSDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPLE
EVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRMTELKSQMKSELAAVASEFGRLTRFL
AEEQAGLERRLREMHEAQLGRAGAAASRLAEQAAQLSRLLAEAQERSQQGGLRLLQDIKE
TFNRCEEVQLQPPEVWSPDPCQPHSHDFLTDAIVRKMSRMFCQAARVDLTLDPDTAHPAL
MLSPDRRGVRLAERRQEVADHPKRFSADCCVLGAQGFRSGRHYWEEPKEPSWPPARPSLT
SYVCPADRPEFSFT
Download sequence
Identical sequences A0A2K5VRR4 A0A2K6CN41
ENSMMUP00000004806 XP_001104049.2.72884 XP_005558899.1.63531 XP_011743351.1.29376 9544.ENSMMUP00000004808 ENSMMUP00000004808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]