SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004814 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004814
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 644-708
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-18
Family LIM domain 0.0092
Further Details:      
 
Domain Number 3 Region: 585-648
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.14e-17
Family LIM domain 0.0096
Further Details:      
 
Domain Number 4 Region: 552-583
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000143
Family LIM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 704-728
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000222
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004814   Gene: ENSMMUG00000003608   Transcript: ENSMMUT00000005110
Sequence length 735
Comment pep:known chromosome:MMUL_1:9:50561545:50593221:-1 gene:ENSMMUG00000003608 transcript:ENSMMUT00000005110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPVQTPLPVIPHQKDPALDTNGSLVAP
SPSPEARASPGTPGTPELRPTFSPAFSPPSAFSSLAEASAPGPPRVRLRAKTSPDGARDL
LGPKALPGSSQPRQYNNPIGLYSAETLREMAQMYQMSLRGKASGVGLPGGSLPIKDLAVD
SASPVYQAVIKNQNKPEDEADEWARRSSNLQSRSFRILAQMTGTEFMQDPDEEALRRSST
PIEHAPVCTSQATTPLLPASAQPSAAASPSAASPPLATAAAHTAITSAAATAPASSPADS
PRPQASSYSPATAASSAPATHTSYSEGPAAPAPKPRVVTTASIRPSVYQPVPASTYSPSP
GANYSPTPYTPSPTPAYTPSPAPAYTPSPAPAYTPSPAPTYTPSPALAYTPSPAPNYNPA
PSAAYSGGPAEPASRPPWVTDDSFSQKFAPGKSTTSISKQTLPRGGPAYTPAGPQVPPLA
RGTVQRAERFPASSRTPLCGHCNNVIRGPFLVAMGRSWHPEEFNCAYCKSSLADVCFVEE
QNNVYCERCYEQFFAPLCAKCNTKIMGEVMHALRQTWHTTCFVCAACKKPFGNSLFHMED
GEPYCEKDYINLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSK
KDRPLCKKHAHTINL
Download sequence
Identical sequences ENSMMUP00000004815 ENSMMUP00000004814 XP_015002569.1.72884 9544.ENSMMUP00000004815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]