SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004979 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004979
Domain Number 1 Region: 2143-2440
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.84e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000434
Further Details:      
 
Domain Number 2 Region: 633-741
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 3 Region: 1319-1426
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-28
Family PDZ domain 0.0000199
Further Details:      
 
Domain Number 4 Region: 1047-1151
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-27
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 5 Region: 743-849
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-26
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 6 Region: 1752-1841
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-22
Family PDZ domain 0.013
Further Details:      
 
Domain Number 7 Region: 1460-1563
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-20
Family PDZ domain 0.028
Further Details:      
 
Domain Number 8 Region: 539-633
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-17
Family First domain of FERM 0.014
Further Details:      
 
Domain Number 9 Region: 1844-1934
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-16
Family PDZ domain 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004979
Domain Number - Region: 43-100
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.071
Family Protein kinases, catalytic subunit 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004979   Gene: ENSMMUG00000003726   Transcript: ENSMMUT00000005285
Sequence length 2455
Comment pep:known chromosome:MMUL_1:5:79547617:79771850:1 gene:ENSMMUG00000003726 transcript:ENSMMUT00000005285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKPVSLADPAAVGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSLSSLSD
VEKIYIYSLGMTLYWGADHEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSA
HIRNSNCAPSFSYVKHLVKLVLGNLSGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSS
TSDVLDIQKAPLSHQTFLNKGLSKSMGFLSIRDTQDEEDYFKDILSDNSGHEDSENTCSP
YQFKTSGPEKKPIPGIDVLPKKKIWASSMDLLCTADRDFSSGETATYRRCHPEAVTVRTS
TTPRKKEARYSDGSIALDIFGPQKMDPIYHTRELPTSSAISSALDRIRERQKKLQVLREA
MNVEEPVRRYKTYHGDVFSTSSESPSVISSESDFRQELVKRSEASKRFESSSGLPEVDET
LSQSQSQRPSRQYETPFEGNLINQEIMLKRQEEELMQLQAKMALRQSRLSLYPGDTIKAS
MLDITRDPLREIALETAMTQRKLRNFFGPEFVKMTIEPFISLDLPRSILTKKGKNEDNRR
KVNIMLLNGQRLELTCDTKTICKDVFDMVVAHIGLVEHHLFALATLKDNEYFFVDPDLKL
TKVAPEGWKEEPKKKTKATVNFTLFFRIKFFVDDVSLIQHTLTCHQYYLQLRKDILEERM
HCDDETSLLLASLALQAEYGDYQPEVHGVSYFRMEHYLPARVMEKLDLSYIKEELPKLHN
TYVGASEKETELEFLKVCQRLTEYGVHFHRVHPEKKSQTGILLGVCSKGVLVFEVHNGVR
TLVLRFPWRETKKISFSKKKITLQNTSDGIKHAFQTDNGKVCQYLLHLCSSQHKFQLQMR
ARQSNQDAQDIERASFRSLNLQAESVRGFNMGRAISTGSLASSTLNKLAVRPLSVQAEIL
KRLSCSELSLYQPLQNSSKEKNDKASWEEKPREMSKSYHDLSQASLYPHWKNVIVNMEPP
PQTVAELVGKPSHQMSRSDAESLAGVTKLNNSKSVVSLNRSPERRKHESDSSSIEDPGQA
YVLGTTMHSCGNSSSQVPLKENVDVLHKRWSIVSSPEREITLVNLKKDAKYGLGFQIIGG
EKMGRLDLGIFISSITPGGPADLDGCLKPGDRLISVNSVSLEGVSHHAAIEILQNAPEDV
TLVISQPKEKISKVPSTPVHLTNGMKNYMKKSSYMQDSATDSSSKDHHWSRGTLRHISEN
SFGLSGGLREGSLSSQDSRTESASLSQSQVNGFFVSHLGDQTWQESQHGSPSPSIISKAT
EKTSTDSNQSKTKKPGISDATDYSDRGDSDMDEATYSSSQDHQTPKKESSSSVNTSNKMN
FKTFSSSPPKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPKGAAESDGRI
HKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPTSKEHIPVTPQCTLSDQ
NAHGQGPEKVKKATQVKDYSFVTEENTFEVKLFKNSSGLGFSFSREDNLIPEQINASIVR
VKKLFPGQPAAESGKIDVGDVILKVNGASLKGLSQQEVISALRGTAPEVFLLLCRPPPGV
LPEIDTALLTPLQSPAQVLPNSSKDSSQPSCVEQSTSSDENEMSDKSKKHCKSPSRRDSY
SDSSGSGEDDLVTAPANISNSTWSSALHQTLSSMVSQAQSHHEAPKSQEDTICTMFYYPQ
KIPSKPEFEDSNPSSPLPPDMAPGQSYQPQSESASSNSMDKYHIHHISEPTRQENWTPLK
NDLENHLEDFELEVELLITLIKSEKGSLGFTVTKGNQRIGCYVHDVIQDPAKSDGRLKPG
DRLIKVNDTDVTNMTHTDAVNLLRAASKTVRLLIGRVLELPRIPMLPHLLPDITLTCNKE
ELGFSLSGGHDSLYQVVYISDINPTSIAAIEGNLQLLDVIHYVNGVSTQGMTLEEINRAL
DMSFPSLVLKATRNDLPVVPSSKRSAVSAPKHSKLNIGSYSVGSCSQPALTPNDSFSTVD
GEEINEISYPKGKCSTYQIKGSPNLALSKESCIQEDDIYDDPQEAEVIQSLLDVVDEEAQ
NLLNQNNAAGNSCVPGTLKMNGRLSAERTEDTDCDGSPLPEYLTEPTKMNGCEEYCEEKV
KSESLIQKSQEKKTDDDAITWGSDELPTERTNYEDSDKDHSFLTNEELAVLPVVKVLPSG
KYTGANLKSVIRVLRGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRYKNILPYD
ATRVPLGDEGGYINASFIKIPVGKEEFVYIACQGPLPSTVGDFWQMIWEQKSTVIAMMTQ
EVEGEKIKCQRYWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHISH
LNFTAWPDHDTPSHPDDLLTFISYMRHIHRSGPVITHCSAGIGRSGTLICIDVVLGLISQ
DLDFDISDLVRCMRLQRHGMVQTEDQYIFCYQVILYVLTRLQAEEEQKQQPQLLK
Download sequence
Identical sequences 9544.ENSMMUP00000004975 ENSMMUP00000004975 ENSMMUP00000004979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]