SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005313 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005313
Domain Number 1 Region: 243-313
Classification Level Classification E-value
Superfamily Homeodomain-like 7.7e-18
Family Homeodomain 0.0000519
Further Details:      
 
Domain Number 2 Region: 129-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000112
Family LIM domain 0.021
Further Details:      
 
Domain Number 3 Region: 100-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000228
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005313   Gene: ENSMMUG00000003984   Transcript: ENSMMUT00000005645
Sequence length 423
Comment pep:known chromosome:MMUL_1:6:48930898:48940677:1 gene:ENSMMUG00000003984 transcript:ENSMMUT00000005645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRKRGARAAPSPPPPQRLRSTNSAGLNWTPRSARALRSRAAALSALATPGATISHLATAP
ASSLWAVHQLYNHHFTVDITPSYRYGRHGRSTKNSEKRLISLCVGCGNQIHDQYILRVSP
DLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYIRLFGVALSFCGLPLWSHSFLKL
VTYKFFCKISLFKCLVAVNNLLDWSIFTPVEIVFCSIAHRVVEPSAHGASCPAAEPISAR
QPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIR
VWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQS
YQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASP
IEA
Download sequence
Identical sequences ENSMMUP00000005313 9544.ENSMMUP00000005313 ENSMMUP00000005313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]