SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005590 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005590
Domain Number 1 Region: 44-146
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000293
Family Ubiquitin-related 0.048
Further Details:      
 
Domain Number 2 Region: 138-231
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000196
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 3 Region: 612-675
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000678
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 4 Region: 899-937
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000093
Family Ras-binding domain, RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005590   Gene: ENSMMUG00000004177   Transcript: ENSMMUT00000005935
Sequence length 938
Comment pep:known chromosome:MMUL_1:13:134081593:134093876:1 gene:ENSMMUG00000004177 transcript:ENSMMUT00000005935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYLLNFIGQGPATYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKKHIPIQVILATGES
LTVSVDSASTSREVCMHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGRDHVMDAIAQCEQL
AQERSESQRQSPWRIYFRKEFFAPWHDSREDPVSTELIYRQVLHGVWSGEYSFEKEEELV
ELLARHCYVQLGASVESKAVQELLPSCIPHRLYRTKPPERWASLVTAACAKVSLHAAQAP
SRGLSFRRSPLSSAVCHRPMPPSSFQAGILDGSLCWSALQSSPRWVLGNPPGQTPLFKEI
TLYSTNSEKKVRLDIMVADGHGTVVLGRGTETKQSSREEERSARDTDSEQDALLHGARDR
ERLSSLLLTARWLMPVIPALWEAKTGGSPEVRSLRPAWPTWQNPVSTETTEISQAQWHMP
VVPATWVETLSQKRKKKKKKKKNRAAPVPGDVPGPSLQDPSPGTGLALSRGFSEGSTNSF
TLSTGGKPHHWLCESRWWMPPACSGHCSSPGSLKDPMQPSHGRLSWPGPRLPKTQLILAV
NWKGLCFLDQREKTLLELSFPEVMGLVANREAQGRQRLLLSTMHEEYEFVSPSSVAIAEL
VALFLEGLKERSVFAMALQDRKATDDATLLAFKKGDLLVLTKKQRLLASENWTLGQNDRT
GKTGLVPTACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGKLAEPRPEEPPKEKPHTL
EEFSYEFFRAPEKDTVSMAVLPLARARGHLWAYSSEPLRQPLLKRVHANVDLWDIACQIF
PILRYMGDYPSRQAWPSLELTDQIFTLALQHPALQDEVYCQLLKQLTHNSNRHSEERGWQ
LLWLCTGLFPPSKGLLPHAQKFIDTRRGKLLAPDCGRRIQRVLRTGPRKQPPHQVEVEAA
EQNISRICHKVYLPNDTSEMLEVVANTRVRDVCDSIAT
Download sequence
Identical sequences ENSMMUP00000005590 9544.ENSMMUP00000005590 ENSMMUP00000005590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]