SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005912 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005912
Domain Number 1 Region: 72-199
Classification Level Classification E-value
Superfamily PX domain 3.92e-16
Family PX domain 0.0075
Further Details:      
 
Domain Number 2 Region: 841-869
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000244
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005912   Gene: ENSMMUG00000004434   Transcript: ENSMMUT00000006285
Sequence length 899
Comment pep:known chromosome:MMUL_1:18:55893230:55951623:1 gene:ENSMMUG00000004434 transcript:ENSMMUT00000006285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREHLERLRAALRGGPEDAEVEVEPCKFAGPRAQNNSAHGDYMQNNESSLIEQAPIPQDG
LTVAPHRAQREAVHIEKIVLKGVQRKRADKYWEYTFKVNWSDLSVTTVTKTHQELQEFLL
KLPKELSSETFDKTILRALNQGSLKREERRHPDLEPILRQLFSSSSQAFLQSQKVHSFFQ
SISSDSLHSLNNLQSSLKTSKILEHLKEDSSEASSQEEDVLQHTIIHKKHTGKNPIVNSI
GTSCSPLDGLTMQYSEQNGIVDWRKQSCTTIQHPEHCVTSADQHSAEKRSLSSINKKKGK
PQTEKEKIKKTDNRLNSRINGIRLSTPQHAHGGAVKDVNLDIGSGHDTCGETSSESYSSP
SSPRHDGRESFESEEEKDRDTDSNSEDSGNPSTTRFTGYGSVNQTVTVKPPVQIAPLGNE
NGNLLEDPLNSPKYQHISFMPTLHCVMHNGAQKSDVVVPAPKPTDGKTIGMLVPSPVAIS
AIRESANSTPVGILGPAASTAESEKHLELLASPLPIPSTFLPHSSTPALHLTVQRLKLPP
PQGSSESCTVNIPQQPPGSLSIGSPNTAFIPIHNPGSFPGSPVATTDPITKSASQVVGLN
QMVPQIEGNTGTVPQPTNVKVVLPAAGLSAAQPPASYPLPGSPLAAGVLPSQNSSVLSTA
ATSPQPASAGISQAQATVPPAVPTHTPGPAPSPSPALTHSTAQSDSTSYISAVGNTNANG
TVGPPQQMGSGPCGSCGRRCSCGTNGNLQLNSYYYPNPMPGPMYRVPSFFTLPSICNGSY
LNQAHQSNGNQLPFFLPQTPYANGLVHDPVMGSQANYGMQQMAGFGRFYPVYPAPNVVAN
TSGSGPKKNGNVSCYNCGVSGHYAQDCKQSSMEANQQGTYRLRYAPPLPPSNDTLDSAD
Download sequence
Identical sequences 9544.ENSMMUP00000005912 ENSMMUP00000005912 ENSMMUP00000005912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]