SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005917 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005917
Domain Number 1 Region: 699-1051
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-119
Family Hect, E3 ligase catalytic domain 0.000000112
Further Details:      
 
Domain Number 2 Region: 2-346
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.49e-103
Family Regulator of chromosome condensation RCC1 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005917   Gene: ENSMMUG00000010105   Transcript: ENSMMUT00000006290
Sequence length 1057
Comment pep:known chromosome:MMUL_1:9:69210491:69331666:1 gene:ENSMMUG00000010105 transcript:ENSMMUT00000006290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKKVRDVGCGLRHTVFVLDDGTVYTCGC
NDLGQLGHEKSRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLLG
SEECIRVPRNIKSLSDIQIIQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTS
PQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLR
SQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQIA
CGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWYPYNGQCLPDTDSEE
YFCVKRIFSGGDQSFSHYSNPQNCGPPDDFRCPDPTKQIWTVNEVLIQKWLSYPSGRFPV
EIANEIDGTFSSSGCLNGSFLAVSNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQ
QVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAP
LKVLENWWSVLEPPLFLKIVELFKEVVVHLLKLYKIGIPPSERRIFNSFLHTALKVLEIL
HRVNEKTGQIIQYDKFYIHEVQELIDIRNDYINWVQQQAYGMDVNHGLTELADIPVTICT
YPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVG
DAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSR
LIWFSDKTFEDSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKKKPSLDDLKELMPD
VGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAY
VDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKG
EYWAEHPTIKIFWEVFHELPLEKKQQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLP
VSHTCFNLLDLPKYTDKETLRSKLIQAIDHNEGFSLI
Download sequence
Identical sequences G7PDD3 H9ERW1
ENSMMUP00000035810 NP_001244507.1.72884 XP_005565776.1.63531 9544.ENSMMUP00000035810 ENSMMUP00000005917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]