SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006568 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006568
Domain Number 1 Region: 478-608
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.48e-54
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 128-348
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.92e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000046
Further Details:      
 
Domain Number 3 Region: 299-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.49e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006568   Gene: ENSMMUG00000004954   Transcript: ENSMMUT00000006987
Sequence length 613
Comment pep:known chromosome:MMUL_1:X:128363654:128400453:-1 gene:ENSMMUG00000004954 transcript:ENSMMUT00000006987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTVGAGVYAYKIIKEDEKRYNERISGLGLTPEQKQKKAALSASEG
EEVPQDRVPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRG
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPRSATEQSGTGIRSESETESEASE
IAIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
Download sequence
Identical sequences F7C7H6
ENSMMUP00000006568 XP_014983657.1.72884 9544.ENSMMUP00000006568 ENSMMUP00000006568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]