SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006658 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006658
Domain Number 1 Region: 113-251
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.83e-41
Family RPR domain (SMART 00582 ) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006658   Gene: ENSMMUG00000005029   Transcript: ENSMMUT00000007086
Sequence length 1578
Comment pep:known chromosome:MMUL_1:14:81413868:81441954:1 gene:ENSMMUG00000005029 transcript:ENSMMUT00000007086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWEHRHFRSWSRHCRRHFVSVEKEASVAAGSGRRSPARRRRFIPEVPPVSSPIPPPRSAC
GEAGAARDPGRGRGVGREAGYPERLQLQLRRTSEGGRGAMSEQTPAEAGAAGAREDACRD
YQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEAQTAKAPSSEKLPVMYLMDSIV
KNVGREYLTAFTKNLVATFICVFEKVDENTRKSLFKLRSTWDEIFPLKKLYALDVRVNSL
DPAWPIKPLPPNVNTSSIHVNPKFLNKSPEEPSTPGTVVSSPSISTPPIVPDIQKNLTQE
QLIRQQLLAKQKQLLELQQKKLELELEQAKAQLAVSLSVQQETSNLGPGSAPSKLHVSQI
PSMAVKAPHQVPVQSEKSRPGPSLQIQDVKGTNRDPRLNRMSQHSHGKDQSHRKEFLMNT
LNQSDIKTSKTIPSEKLNSSKQEKSKSGEKITKKELEQLDSKSKSKSKSPSPLKNKLSHT
KDLKNQESESMRLSDMNKRDPRLKKHLQDKTDGKDDDVKEKRKTAEKKDKDEHMKSSEHR
LAGSRNKIINGIVQKQDTITEESEKQGTKPGRSSTRKRSRSRSPKSRSPIIHSPKRRDRR
SPKRRQRSMSPTSTPKAGKIRQSGVKQSHMEEFTPPSREDRNAKRSTKQDIRDPRRMKKT
EEERPQETTNQHSTKSGTEPKENVENWQSSKSAKRWKSGWEENKSLQQVDEHSKPPHLRH
RESWSSTKGILSPRAPKQQQHRLSVDANLQIPKELTLASKRELLQKTSERLASGEITQDD
FLVVVHQIRQLFQYQEGVREEQRSPFNDRFPLKRPRYEDSDKPFVDSPASRFAGLDTNQR
LTALAEDRPLFDGPGRPSVARDGPTKMIFEGPNKLSPRIDGPPTPASLRFDGSPGQMGGG
GPLRFEGPQGQLGGGCPLRFEGPPGPVGTPLRFEGPIGQAGGGGFRFEGSPGLRFEGSAG
GLRFEGPGGQPVGGLRFEGHRGQPVGGLRFEGPHGQPVGGLRFDNPRGQPVGGLRFEGGH
GPSGAAIRFDGPHGQPGGGIRFEGPLLQQGVGMRFEGPHGQSVAGLRFEGQHNQLGGNLR
FEGPHGQPGVGIRFEGPLVQQGGGMRFEGPSIDGVQRFDGPQHQQTSRFDIPLLQGTRFD
NHPSQRLESVSFNQTGPYNDPPGNAFNAPSQGLQFQRHEQIFDSPQGPNFNGPHGPGNQS
FSNPLNRASGHYFDEKNLQSSQFGNFGNIPAPMTVGNIQASQQVLSGVAQPVAFGQGQQF
LPVHPQNPGFVQNPSGALPKAYPDNHLSQVDVNELFSKLLKTGILKLSQPDSATTQVSEV
AAQPPPEEEEDQNEDQDVPDLTNFTVEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDV
YADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVV
LKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPS
CYDDYQNTSSFDCTPSPSKTPAENPLNIMLNIVKNELQEPCESPKVKEERIDTPPACTEE
SIATPSEIKTENDTVESV
Download sequence
Identical sequences ENSMMUP00000006658 ENSMMUP00000006658 9544.ENSMMUP00000006658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]