SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006948 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006948
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-41
Family Galectin (animal S-lectin) 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006948   Gene: ENSMMUG00000003527   Transcript: ENSMMUT00000007392
Sequence length 139
Comment pep:known chromosome:MMUL_1:19:45918056:45975680:-1 gene:ENSMMUG00000003527 transcript:ENSMMUT00000007392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKSLPVPYKLPVSLSVGSCVIIKGTPIDSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGN
HVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSF
VKMMQVSRDVSLTSVCVCN
Download sequence
Identical sequences ENSMMUP00000006948 ENSMMUP00000012459 9544.ENSMMUP00000006948 ENSMMUP00000006948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]