SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007446 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007446
Domain Number 1 Region: 478-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-50
Family SPRY domain 0.00074
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000103
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 4 Region: 372-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000138
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007446
Domain Number - Region: 107-159
Classification Level Classification E-value
Superfamily RING/U-box 0.00132
Family ZZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007446   Gene: ENSMMUG00000020179   Transcript: ENSMMUT00000007921
Sequence length 667
Comment pep:known chromosome:MMUL_1:X:8079275:8220843:-1 gene:ENSMMUG00000020179 transcript:ENSMMUT00000007921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDAHTMTSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSIAFYDALNSIHLYTFDVAFAQPVCPTFTVWNKCLTIITGLPIPDHL
DCTEQLP
Download sequence
Identical sequences A0A1D5QL73
9544.ENSMMUP00000026572 ENSMMUP00000007446 XP_001093502.1.72884 XP_014982415.1.72884 XP_014982416.1.72884 XP_014982417.1.72884 ENSMMUP00000007446 ENSMMUP00000026572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]