SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007479 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007479
Domain Number 1 Region: 165-513
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 1.28e-115
Family Inosine monophosphate dehydrogenase (IMPDH) 0.0000000000741
Further Details:      
 
Domain Number 2 Region: 18-131
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 4.39e-29
Family Inosine monophosphate dehydrogenase (IMPDH) 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007479   Gene: ENSMMUG00000005656   Transcript: ENSMMUT00000007958
Sequence length 514
Comment pep:known chromosome:MMUL_1:2:87428652:87433660:1 gene:ENSMMUG00000005656 transcript:ENSMMUT00000007958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCLLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKEKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Download sequence
Identical sequences A0A0D9RRV1 A0A2K5JRG8 A0A2K5LJT8 A0A2K5ZLJ4 G7NXU9 H9YWM9
XP_005547127.1.63531 XP_007982376.1.81039 XP_011836344.1.47321 XP_011889019.1.92194 XP_014986439.1.72884 ENSMMUP00000007479 ENSMMUP00000007479 9544.ENSMMUP00000007479 ENSPANP00000015357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]