SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007639 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007639
Domain Number 1 Region: 450-628
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-51
Family SPRY domain 0.00074
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-19
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 148-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000029
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007639   Gene: ENSMMUG00000005790   Transcript: ENSMMUT00000008123
Sequence length 630
Comment pep:known chromosome:MMUL_1:16:41109850:41133925:-1 gene:ENSMMUG00000005790 transcript:ENSMMUT00000008123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGAPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQAELAREPPADGWTPPARASAPSPGAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQSPVRDLLRRKCSQHNRLREFFCPEHGECICHICL
VEHKACSPASLSQASANLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LRQEYTEMKALLDASETTSTRKIKEEEKRVNTKFDTIYQILLKKKSEIQTLKEEIEQGLT
EGDEFEFLEKASKLRGISTKPVYIPEVELNRKLIKGIYHSTLDLKNELKQCIRQLQEPTP
SSGDPGEHDPASTQKSTRPAKKVSKEEKKSKKPPSVPASSSKLPTFGAPEQLVDLKQPGS
EAAAKATSSHPNSASLKAKVLETFLAKSRPELLEYYVKVILDYNTAHNKVALSESYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADRVHLM
YKFKVDFTEALYPAFWVFSAGATLSICSPK
Download sequence
Identical sequences A0A2K6E4E5 F6VU89 G7PUD8
ENSMMUP00000007639 ENSMMUP00000007639 XP_005583855.1.63531 XP_011731282.1.29376 XP_014974667.1.72884 9544.ENSMMUP00000007639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]