SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007643 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007643
Domain Number 1 Region: 247-337
Classification Level Classification E-value
Superfamily Fibronectin type III 9.21e-18
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 116-178
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000141
Family Ankyrin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007643   Gene: ENSMMUG00000005793   Transcript: ENSMMUT00000008127
Sequence length 742
Comment pep:known chromosome:MMUL_1:16:40550048:40695908:1 gene:ENSMMUG00000005793 transcript:ENSMMUT00000008127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGRKFACFAQRLSHRRKQSQCDLLNESTGQLPTTCSSAASNSINWNCCVKMTQQMQNLHL
CQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRTRTDRLSLRKTSVNFQGNEAM
FEAVEQQDMDAVQILLCQYTPEELDLNTPNSEGLTPLDIAIMTNNVPIARILLRTGAQES
PHFVSLESRAMHLNTLVQEAQERVSELSAQVENEGFTLDNTEKEKQLKAWEWRYRLYRRM
KTGFEHARAPEMPTNVCLMVTSSTSLTVSFQEPLSVNAAVVTRYKVEWSMSKDFSPLAGE
IIMDNLQTLRCTITGLTMGQQYYVQVSAYNMKGWGPAQTTTPACASPSNWKDYDDREPRH
KGQSEVLEGLLQQVRALHQHYSCRESTKLQTTGRKQSVSRSLKHLFHSSNKFVKTLKRGL
YIAVIFYYKDNILVTNEDQVPIVEIDDSHTSSITPDFLWFTKLSCMWEDIRWLRQSVPIS
SSSSTVLQTRQKMLSATAQLQNLLGTHNLGRVYYEPIKDRHGNILIVTIREVEMLYSFFN
GKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYHKRSHQRLSPGLYLGYLKLCSS
VDQIKVLVTQKLPNILCHVKIRENNNISREEWEWIQKLSGSESMESVDHTSDCPMQLFFY
ELQMAVKALLQQINIPLHQARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYT
PHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences ENSMMUP00000007643 ENSMMUP00000007643 9544.ENSMMUP00000007643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]