SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007680 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007680
Domain Number 1 Region: 108-228
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.77e-24
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Domain Number 2 Region: 38-114
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-20
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007680   Gene: ENSMMUG00000005826   Transcript: ENSMMUT00000008166
Sequence length 340
Comment pep:known chromosome:MMUL_1:8:142108601:142201117:-1 gene:ENSMMUG00000005826 transcript:ENSMMUT00000008166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTI
GYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDV
SMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGAL
QKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIH
IPEEPRPSRPRYKADVADLQSVCSCTCYRSQDYGGRSAAPQNSFSAKLAPHYFHSISYKI
EEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
Download sequence
Identical sequences 9544.ENSMMUP00000007680 ENSMMUP00000007680 ENSMMUP00000007680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]