SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007840 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007840
Domain Number 1 Region: 229-508
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-82
Family Kelch motif 0.00000373
Further Details:      
 
Domain Number 2 Region: 1-70
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000359
Family BTB/POZ domain 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007840
Domain Number - Region: 89-204
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family MIF4G domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007840   Gene: ENSMMUG00000005961   Transcript: ENSMMUT00000008345
Sequence length 544
Comment pep:known chromosome:MMUL_1:16:51939993:51947042:1 gene:ENSMMUG00000005961 transcript:ENSMMUT00000008345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RALFTSGWNNTEKKVYNIPGISPDMMKLIIEYAYTRTVPITPDNVEKLLAAADQFNIMGI
VRGCCEFLKSELCLDNCIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLELSVT
ELKDIIEKDELNVKQEDAVFEAILKWISHDPQNRKQHISILLPKVRLALMHAEYFMNNVK
MNDYVKDSEECKPVIINALKAMYDLNMNGPSNSDFTNPLTRPRLPYAILFAIGGWSGGSP
TNAIEAYDARADRWVNVTCEEESPRAYHGAAYLKGYVYIIGGFDSVDYFNSVKRFDPVKK
TWHQVAPMHSRRCYVSVTVLSNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAPMHEQRS
DASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAPMRSRRSGIGVIAYGEHVYA
VGGFDGANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTTTFNV
ECYDEKTDEWYDAHDMSIYRSALSCCVVPGLANVGEYAARRDNFPGLALRDEVKYSASTS
TLPV
Download sequence
Identical sequences ENSMMUP00000007840 9544.ENSMMUP00000007840 ENSMMUP00000007840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]