SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007905 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007905
Domain Number 1 Region: 35-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000136
Family V set domains (antibody variable domain-like) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007905   Gene: ENSMMUG00000006017   Transcript: ENSMMUT00000008415
Sequence length 234
Comment pep:known chromosome:MMUL_1:12:67574241:67603115:1 gene:ENSMMUG00000006017 transcript:ENSMMUT00000008415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCGLSALIMCLKGMVAVVVAVDDGDSQALAGNKILVKQSPMLVAYDNAVNLSCKYSYNL
FSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQ
TDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWALVVVGGVLACY
SLLVTVAFCIFWMRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Download sequence
Identical sequences G7N8Q2 G7PL87
ENSMMUP00000007905 XP_011716294.1.29376 XP_014966207.1.72884 XP_015287619.1.63531 9544.ENSMMUP00000037834 ENSMMUP00000037834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]